SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0J1U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0J1U0
Domain Number 1 Region: 145-320
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-20
Family UAS domain 0.028
Further Details:      
 
Domain Number 2 Region: 367-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000646
Family UBX domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0J1U0
Sequence length 513
Comment (tr|A0A0V0J1U0|A0A0V0J1U0_SCHSO) FAS-associated factor 2 {ECO:0000313|EMBL:JAP59523.1} OX=70667 OS=Schistocephalus solidus (Tapeworm). GN=TR140348 OC=Diphyllobothriidea; Diphyllobothriidae; Schistocephalus.
Sequence
MASVGAEDARDAPYDVSALSEAKRRDLHHFKDISGIADDDCAARILEESDWNLEHAVHKF
MGLGESGNLAGAARRRSQNRPENPAPIDLAPPNLLVFRRDRPIGGWFQTFLNILLSPIYF
TYNVFSSIISTFTSFLWPDPRTLVTDPLGDVRNFIDTFKQTYAPVSEDSISTDTIERNTT
PPFFEGTYAQALQEAKRSLRFLIVYLHCGSHEDTEEFCRQTLQHPITLAFLNDTQQCIFW
ACDINSPEGYRTSQIFREHSYPFVGVIGLSVNRAHSSSSYGPPSRMALLGRIEGLVSATD
FVEQLSNIINNNQTALLAARAEREERDFTNRLRREQDEAYAASLAADRAKDAERTAALEA
EAARAREAADAEARRQQLEVARRRRQQRWHRSLPQQPPQGTPGTVKLSTKLPNGNRAERI
FSTQDSVKHLYYFIISQEGAPKNFDIEANFPKRILDCRPADESDIEDYLSTDVSGDANVS
KSDDWTPKTGDPPSFEALNLTNPELLFVLDRDA
Download sequence
Identical sequences A0A0V0J1U0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]