SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0WEZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0WEZ2
Domain Number 1 Region: 859-1024
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.59e-43
Family Lysophospholipase 0.072
Further Details:      
 
Domain Number 2 Region: 528-649
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-20
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 1027-1183
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.25e-19
Family Lysophospholipase 0.033
Further Details:      
 
Domain Number 4 Region: 158-287
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-16
Family cAMP-binding domain 0.02
Further Details:      
 
Domain Number 5 Region: 400-501
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000838
Family cAMP-binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0WEZ2
Sequence length 1351
Comment (tr|A0A0V0WEZ2|A0A0V0WEZ2_9BILA) Neuropathy target esterase sws {ECO:0000313|EMBL:KRX74337.1} KW=Complete proteome; Reference proteome OX=92179 OS=Trichinella sp. T6. GN=T06_13124 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LVEILTKDGCIHAVHSATLRGANNYPTINHFKNLKIITIGMGCIFITWVINRFMRLNVAT
SSGTKYPVTFSRKSSFNYRFRKRDRMLFYGRKLMRKVTSAVINGDKKQKLRKRDRVFRFA
SKFLRPQKKDSTARPIRRPPDAFLEADTSLPVSPKSVQLLNMLKSIRILGHFEIPFFLDV
CKHIETKRFAADQFVFKDGEIHDCIYIVESGRLSLFIKDEKFDFEVKSVGRGDSLYCSLN
ILDMIKNQARPMKNVFAKATEESVVLQLKSSVFNDIFDKYPESWTRTVQIILLRFQRITL
ATLYRYFGFTSELSKTVQLYRIIFLLLYGLNFQSIRAVSKLSPLQEQSCKDFREIKSENE
GATPEDCTASENAFPTFGVSTTDDDSDIFQVAIEELAKLFGMKEASFLVDKVKVEKFEPG
IMIVRQGSNELQLFYVVSGMLELLLESQEDPDVLLPISIVQTGDVIGGLSVLSGEPSFFA
VRTRSYCQLAIVERKSLYECVTFLNRIISEYPRVVVNVASTAVESYSDFVKEFDMAVEWE
ICESGKALYKQNEQADALYVVLSGRLRSVLTREPGTREVLNEHGRGDVVGLVEIWTLRRR
STSVIAIRDTELCKIYATLMNFIKNKHPQVLSNIIRLLGHCIIEQQQQTVSAVHREPLAH
VSNLNTIAVLAVSDEVPLTGFTVELWNALNSITPTELFSSYTLQDMLGPTALDKVNEYQI
ITWLNQQEDGNSIVLYQCDVELTTFTSLCIRRADCILIVANGEQEPMVGEIEKELENLTV
RAQKELILLWHDSTDRPRRTAEWLDLHGWVSSHYHVRFRDRVFKQRNPRRMLRYKERIIR
RCDNRHTDIARLARALTSTSIGIVLGGGGARGAAHVGIIKALKDHGIPVDIVAGVSIGAF
VGGMYCLDSDVPKLIMCAKQAFKEAASFWARLFDLTYPVSALFTGKALNRLLKSVFNDVE
IEDLWIPYFNVTTDITSSEMRVHRSGKLWRFTRASMSYIGILPPLCDPLDGHYLVDGCYM
NNLPGTLWRYCRASMSLAGFVPPIFDLTDEHLLLDGGYVNNLPADVMRSLGVRTVIAVDV
GALTETEFTNYGDYLSGWWALWKKYNPWASPVRVMSMAEIQSRLAYVSCVRQLEEVKKAP
YCHYVRPPIDKYQTFDFNLFDEIFNVGYWHGKTLLEEWKSSGKLHELFDGRSANLSKFAQ
REKFKRGFAFTSAQSFTDLAAMVSKIHRPFETSLDEISEEEGDDRIPLDLIHTTSSSSYR
HCLQKKKYSIIVIFRYYNNNLKMSGHRVVISRDDVDQFDKLLEKSGCAKEHYVLQDCYAE
HKDWRKCKKEIDALRKCMKVEDRTESADNAT
Download sequence
Identical sequences A0A0V0WEZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]