SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1AGE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1AGE3
Domain Number 1 Region: 24-68
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000902
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1AGE3
Sequence length 113
Comment (tr|A0A0V1AGE3|A0A0V1AGE3_9BILA) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KRY23847.1} KW=Complete proteome; Reference proteome OX=990121 OS=Trichinella patagoniensis. GN=T12_1361 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MSSIFGKGNDDGLVMSHRSAWARLCEDYLERHNISDLIKRAVVRLCIAQPDDPVAFLSHY
FQLLEKGENGFSEGEPLRKWFHRVSRSDTLFEKRLSILNRISALLCYRGELKC
Download sequence
Identical sequences A0A0V1AGE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]