SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1D6E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1D6E3
Domain Number 1 Region: 834-999
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.33e-42
Family Lysophospholipase 0.06
Further Details:      
 
Domain Number 2 Region: 1002-1157
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.62e-19
Family Lysophospholipase 0.033
Further Details:      
 
Domain Number 3 Region: 140-272
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-17
Family cAMP-binding domain 0.026
Further Details:      
 
Domain Number 4 Region: 503-624
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-16
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 5 Region: 381-492
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-16
Family cAMP-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1D6E3
Sequence length 1309
Comment (tr|A0A0V1D6E3|A0A0V1D6E3_TRIBR) Neuropathy target esterase sws {ECO:0000313|EMBL:KRY57041.1} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_3628 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MDAFMQFIQLLYENLKIITIGMGCIFITWVINRFMRLNVATSSATKYPVTFSRKSSFNYR
FRKRDRMLFYGRKLMRKVTSAVINGDKKQKLRKRDRVFRFASKFLRPQKKDFTARPIRRP
PDAFLEADTSLPVSPKSVQLLNMLKSIRILGHFEIPFFLDVCKHIETKRFAADQFVFKDG
EIHDCIYIVESGRLSLFIKDEKFDFEVKSVGRGDSLYCSLSILDMIKNQARPMKNVFAKA
TEESVVLQLKSSVFNDIFDKYPESWTRTVQIILLRFQRITLATLYRYFGFTSELSKTVQL
YRIIFLLLYGLNFQSIRAVSKLSPLQEQSCKDFREIKSENEGATPEDCTASENAFPTFGV
STTDDDSDIFQVAIEELAKLFGMKEASFLVDKVKVENFEPGIMIVRQGSNELQLFYVVSG
MLELLLESQEDPDVLLPISIVQTGDVIGGLSVLSGEPSFFAVRTRSFCQLAIVERKSLYE
IISEYPRVVVNVASTAVESYSDFVKEFDMAVEWEICESGKALYKLQNEQADALYVVLSGR
LRSVLTREPGTREVLNEHGRGDVVGLVEIWTLRRRSTSVIAIRDTELCKIYATLMNFIKN
KNPQVLSNIIRLLGHCIIEQQQQTVSAVHREPLAHVSNLNTIAVLAVSDEVPLTGFTVEL
WNALNSITPTELFSSYTLQDMLGPTALDKVNEYQIITWLNQQEDGNSIVLYQCDVELTTF
TSLCIRRADCILIVANGEQEPMVGEIEKELENLTVRAQKELILLWHDSTDRPRRTAEWLD
LHGWVSSHYHVRFRDRVFKQRNPRRMLRYKERIIRRCDNRHTDIARLARALTSTSVGIVF
GGGGARGAAHVGIIKALKDHGIPVDIVAGVSIGAFVGGMYCLDSDVPKLIMCAKQAFKEA
ASFWARLFDLTYPVSALFTGKALNRLLKSVFNDVEIEDLWIPYFNVTTDITSSEMRVHRS
GKLWRFTRASMSYIGILPPLCDPLDGHYLVDGCYMNNLPGTLWRYCRASMSLAGFVPPIF
DLTDEHLLLDGGYVNNLPADVMRSLGVRTVIAVDVGALTETEFTNYGDSLSGWWALWKKY
NPWASPVRVMSMAEIQSRLAYVSCVRQLEEVKKAPYCHYVRPPIDKYQTFDFNLFDEIFN
VGYWHGKTLLEEWKSSGKLQEVFDGRSANLSKFAQREKFKRGFAFTSAQSFTDLAAMVSK
IHRPFETSLDEISEEEGDDRIPLDLIHTTSSSSYYNNNLKMSGHRVVISRDDVDQFDKLL
EKSGCAKEHYVLQDCYAEHKDWRKCKKEIDALRKCMKVEDRTESADNAT
Download sequence
Identical sequences A0A0V1D6E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]