SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1FX13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1FX13
Domain Number 1 Region: 398-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 191-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000232
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 275-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000691
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 231-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 156-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1FX13
Sequence length 1568
Comment (tr|A0A0V1FX13|A0A0V1FX13_TRIPS) Multiple epidermal growth factor-like domains protein 6 {ECO:0000313|EMBL:KRY90412.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4D_15388 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MYAYVYIYEMFYKRFGQATTIQQRSLLTVLDLSSLITSGLMMHHRLVIVLFFLFSLLTTS
WSVELEVEELKPDMKNVCPHEEVEVVTVQEPCIQAYTRYVRRWKPNCDHQKRWCVISEPK
TIYYRTVKTKQRKERHVRYKCCYGWLPVTGEGCTKPNCTTDLCYNGGSCSSAVAAKLCDC
PPGFQGSRCQYDINECLVDNGGCHHDCSNTIGTFYCRCWPGFQLNSDGKTCVDVNECEVV
NGGCEYRCVNTNGGYRCECPPNKQLHPDGRHCINENSCELNNGGCSQLCQEEGGKFLRCR
CHAGYKLADDKRTCYAIDPCQEDGAKCQHHCVNVNGRADIGWLMTNDLAQANVNECELHH
RGGCEQLCVNIPGSFECQCHEGYRLASDRKHCIKLQASCEVNNGGCEHHCTASVDGGVQC
NCKHGFRLADDGKHCVDIDECVNNNAGCDHQCHNQPGSYYCACRPGFHLSIDQHSCEDIN
ECLNNNGNCQQLCTNVPGSYRCECFLGYSLDGDKKSCNALYLVRSLKSNESSDPFQFNLF
NNKTEYHLELPQSAAAVHHSHLYNYGLNQQECPIGKFGFKCEYSCDDCKNGGRCNRKQSG
CDCRAGWIGIICNESCPEGFWGIGCSNVCSCSNGGLCNPITGECRCLPGYSGESCEVGCP
AGYYGPRCDLPCRMQCPNNICDRTYGYCPCSPGFFGKKCEQTCPPFTYGRNCRHLCKCHR
ENSIGCNEQCACEVSVGCDPVSGMCEPKCKPGFTGPDCKQPCSPNRFGVNCANVCQCPKE
QKCHPASGACTCPAGYTGPKCSQKCPPNRYGPMCMYECVCKNGASCDPETGRCQCTAGFY
GTACTEKCPPGRFGRDCMELCSCMNGAACDPVNGSCACLAGWQGELCDRVCDANTFGANC
AQSCNCTGDVKCDPVSGDCICPPGLQGERCDQPCPSGSYGAGCMGVCACKNGATCDAVSG
RCLCASGWRGWHCDRPCPDGFYGKQCAQICDCGFGSQEGNGALSRCDHVTGECLCPSGWT
GPDCRTPCPPNRWGNGCTETCQCENGGSCDPLTGLCSCQPGWIGKACDQECPAGLHGINC
AQHCHCLNNATCDSRTGKCLCSPGWMGAACEFRCPFGYFGPSCNGVCQCQAGAACDHVTG
ECRCLPGWTGERCDKKCPDGKYGINCSEVCQCEHGASCHHITGHCLCTPGWRGRRCHRPC
IKGYYGRNCAQRCNCPKQNNCDHITGQCSCPAGYTGPTCSHLCPEGKFGQDCHSRCSCSA
NANCDPVTGDCICKPGFSGPGCNEGCVQGKFGFDCKENCTCENGGICDSVFGKCTCPSGF
IGTMCELPCPSNRHGINCIEECPCENGGTCSRTTGQCVCPPGFTGINCKLVCPETKYGAG
CTEKCRCKNGGFCNPVDGTCKCTLGWTGPSCEQECPEGMYGWYCSKFCNCLNGAACDPTT
GQCLCPPGFHGDKCESTCPIGSYGVNCRLKCDCGDYDCDSTTGQCVCPLGFTGPRCQDVC
RSGRYGFNCEQSCKCYNGARCNMFTGQCECAAGWLGATCQREDYSHNVLPSRGDVPNHLN
RAYYYYRR
Download sequence
Identical sequences A0A0V1FX13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]