SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1HZ59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1HZ59
Domain Number 1 Region: 839-1004
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.8e-43
Family Lysophospholipase 0.072
Further Details:      
 
Domain Number 2 Region: 509-629
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-19
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 1007-1162
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.75e-19
Family Lysophospholipase 0.033
Further Details:      
 
Domain Number 4 Region: 387-498
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.3e-17
Family cAMP-binding domain 0.0057
Further Details:      
 
Domain Number 5 Region: 163-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-16
Family cAMP-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1HZ59
Sequence length 1478
Comment (tr|A0A0V1HZ59|A0A0V1HZ59_9BILA) Neuropathy target esterase sws {ECO:0000313|EMBL:KRZ15743.1} KW=Complete proteome; Reference proteome OX=268475 OS=Trichinella zimbabwensis. GN=T11_14623 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVSGLYYVLVEILTKDGCVHAIHSATLRDSAVDLHYFKLCNYFQVIRQFFNNFFSFPNQL
YSASSATKYPVTFSRKSSFNYRFRKRDRMLFYGRKLMRKVTSAVINGDKKQKLRKRDRVF
RFASKFLRPQKKDFTARPIRRPPDAFLEADTTSLPVSPKSIQLLNMLKSIRILGHFEIPF
FLDVCKHIETKRFASDQFVFKDGEIHDCIYIVESGRLSLFIKDEKFDFEVKSVGRGDSLY
CSLSILDMIKNQARPMKNVFAKATEESVVLQLKSSVFNDIFDKYPESWTRTVQIILLRFQ
RITLATLYRYFGFTSELSKTGIRTVSKLSPLQEQPCKDFREIKSENEGAAPEDCPTSENV
IPTFVASTTDDDSDIFQVAIEELAKLFGMKEASFLVDKVKVENFEPGVMIVRQGSNELQL
FYVVSGLLELLLESQEEPDVLLPISIVQTGDVVGGLSVLTGEPSFFAVRTRSFCQLAIVE
RKSLYEIISEYPRVVVNVASAAVESYSDFVKEFDMAVDWEICESGKALYKQNEQADALYV
VLSGRLRSVLTREPGTREVLNEHGRGDVVGLVEIWTLRRRSTSVIAIRDTELCKIYATLM
NFIKSKHPQVLSNIIRLLGRCIIEQQQQTISAVHREPLAHVSNLNTIAVIAVSDEVPLTG
FTVELWNALNSITPTELFSSYTLQDMLGPTALDKVNEYQIITWLNQQEDGNSIVLYQCDV
ELTTFTSLCIRRADCILIVANGEQEPMVGEIEKELENLTVRAQKELILLWHDSTDRPRRT
AEWLDLHGWVSSHYHVRFRDRVFKQRNPKRMLRYKERIIRRYDNRYTDIARLARALTSTS
IGIVLGGGGARGAAHVGIIKALKDHGIPVDIVAGVSIGAFVGGMYCLDSDVPKLIMCAKQ
AFKEAASFWARLFDLTYPVSALFTGKALNRLLKSVFNDVEIEDLWIPYFNVTTDITSSEM
RVHRSGKLWRFTRASMSYIGILPPLCDPIDGHYLVDGCYMNNLPGTLWRYCRASMSLAGF
VPPIFDLTDEHLLLDGGYVNNLPADVMRSLGVRTVIAVDVGALTETEFTNYGDSLSGWWA
LWKKYNPWASPVRVMSMAEIQSRLAYVSCVRQLEEVKKAPYCHYVRPPIDKYQTFDFNLF
DEIFNVGYWHGKTLFEEWKSSGKLQEVFDGRSANISKFAQRDKFKQGFAFTSAQSFTDLA
AMVSKIHRPFETSLDEISEEEGDDRIPLDLAHTAGSSSAKMYWNNNLIMSGQRVVISRDD
VDLFDKLLEKSGCAKQHYILQVIASSSNGIWLIIVESMIYYCAVLVQLIFVKAISANTTA
EFATNSLLLTKAENISEQAEEIFSSNHSSDADDVAMEMTKHCPEVRCYGRNCAIVREFNA
CPVCACPIGSPARGCDRMPKYMYDELFKNGCQNLANPSAPRYPAMTVFRWYRYTNHLDGT
DECRIYMYPYCRDYELNVWPSPKTREECYDYCYKTGMP
Download sequence
Identical sequences A0A0V1HZ59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]