SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1ICT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1ICT3
Domain Number 1 Region: 398-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000127
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 191-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000243
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 275-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000738
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 231-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 156-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000149
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1ICT3
Sequence length 1665
Comment (tr|A0A0V1ICT3|A0A0V1ICT3_TRIPS) Multiple epidermal growth factor-like domains protein 6 {ECO:0000313|EMBL:KRZ20634.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4B_9097 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MYAYVYIYEMFYKRFGQATTIQQRSLLTVLDLSSLITSGLMMHHRLVIVLFFLFSLLTTS
WSVELEVEELKPDMKNVCPHEEVEVVTVQEPCIQAYTRYVRRWKPNCDHQKRWCVISEPK
TIYYRTVKTKQRKERHVRYKCCYGWLPVTGEGCTKPNCTTDLCYNGGSCSSAVAAKLCDC
PPGFQGSRCQYDINECLVDNGGCHHDCSNTIGTFYCRCWPGFQLNSDGKTCVDVNECEVV
NGGCEYRCVNTNGGYRCECPPNKQLHPDGRHCINENSCELNNGGCSQLCQEEGGKFLRCR
CHAGYKLADDKRTCYAIDPCQEDGAKCQHHCVNVNGRADIGWLMTNDLAQANVNECELHH
RGGCEQLCVNIPGSFECQCHEGYRLASDRKHCIKLQASCEVNNGGCEHHCTASVDGGVQC
NCKHGFRLADDGKHCVDIDECVNNNAGCDHQCHNQPGSYYCACRPGFHLSIDQHSCEDIN
ECLNNNGNCQQLCTNVPGSYRCECFLGYSLDGDKKSCNALYLVRSLKSNESSDPFQFNLF
NNKTEYHLELPQSAAAVHHSHLYNYGLNQQECPIGKFGFKCEYSCDDCKNGGRCNRKQSG
CDCRAGWIGIICNESCPEGFWGIGCSNVCSCSNGGLCNPITGECRCLPGYSGESCEVGCP
AGYYGPRCDLPCRMQCPNNICDRTYGYCPCSPGFFGKKCEQTCPPFTYGRNCRHLCKCHR
ENSIGCNEQTGECYCKDGFYGPYCKATCPLGYYGPSCRKQCACEVSVGCDPVSGMCEPKC
KPGFTGPDCKQPCSPNRFGVNCASVCQCPKEQKCHPASGACTCPAGYTGPKCSQKCPPNR
YGPMCMYECVCKNGASCDPETGRCQCTAGFYGTACTEKCPPGRFGRDCMELCSCMNGAAC
DPVNGSCACLAGWQGELCDRGENGFSKMLYYHVFIRRITFICHLVCDANTFGANCAQSCN
CTGDVKCDPVSGDCICPPGLQGERCDQPCPSGSYGAGCMGVCACKNGATCDAVSGRCLCA
SGWRGWHCDRPCPDGFYGKQCAQICDCGFGSQEGNGALSRCDHVTGECLCPSGWTGPDCR
TPCPPNRWGNGCTETCQCENGGSCDPLTGLCSCQPGWIGKACDQECPAGLHGINCAQHCH
CLNNATCDSRTGKCLCSPGWMGAACEFRCPFGYFGPSCNGVCQCQAGAACDHVTGECRCL
PGWTGERCDKKCPDGKYGINCSEVCQCEHGASCHHITGHCLCTPGWRGRRCHRPCIKGYY
GRNCAQRCNCPKQNNCDHITGQCSCPAGYTGPTCSHLCPEGKFGQDCHSRCSCSANANCD
PVTGDCICKPGYSGPGCNEGCVQGKFGFDCKENCTCENGGICDSVFGKCTCPSGFIGTMC
ELPCPSNRHGINCIEECPCENGGTCSRTTGQCVCPPGFTGINCKLVCPETKYGAGCTEKC
RCKNGGFCNPVDGTCKCTLGWTGPSCEQECPKGRYGAGCALECRCHNNAHCDRITGCCDC
PDGFYGSMCEFKCPEGMYGWYCSKFCNCLNGAACDPTTGQCLCPPGFHGDKCESTCPIGS
YGVNCRLKCDCGDYDCDSTTGQCVCPLGFTGPRCQDVCRSGRYGFNCEQSCKCYNGARCN
MFTGQCECAAGWLGATCQREDYSHNVLPSRGDVPNHLNRAYYYRR
Download sequence
Identical sequences A0A0V1ICT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]