SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Y9W4W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Y9W4W6
Domain Number 1 Region: 43-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-16
Family Glutathione peroxidase-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Y9W4W6
Sequence length 206
Comment (tr|A0A0Y9W4W6|A0A0Y9W4W6_PLABE) Thioredoxin-like protein 1, putative {ECO:0000313|EMBL:CXI33317.1} KW=Complete proteome; Reference proteome OX=5821 OS=Plasmodium berghei. GN=PBK173_000163100 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MSCANFNSPYQAEKRRTAENADNQNLESIKKPIDYSDMDLILFPEGSLKNINNTVVNEKH
LVGKSVALFFSNGSDPKCRAFLPFLQQYYKTINEAGSSQKIEIIFVSVDTDRASFEDHKK
HMPWLYIDVADPLTDILKKHFRVMNAYEVPFYGSGPRSDVPCLVVIGSDGREAQLLHVCS
GREEGEKGVLRWDFRNNIYSLNKKGL
Download sequence
Identical sequences A0A077X9T9 A0A0Y9W4W6 Q4YQP4
XP_676444.1.11252 PBANKA_082020 gi|68069067|ref|XP_676444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]