SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101DFM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101DFM8
Domain Number 1 Region: 5-245
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.3e-132
Family Sir2 family of transcriptional regulators 0.000000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A101DFM8
Sequence length 253
Comment (tr|A0A101DFM8|A0A101DFM8_ARCFL) Regulatory protein SIR2 homolog {ECO:0000256|HAMAP-Rule:MF_01121} KW=Complete proteome OX=2234 OS=Archaeoglobus fulgidus. GN=XD40_0218 OC=Archaeoglobaceae; Archaeoglobus.
Sequence
MEDEIRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPEEVASISGFKRNP
RAFWEFSMEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLELHGS
MDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGEPLPQRTLFEAIEE
AKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTMADPIFDVKIIGKAGEVLP
KIVEEVKRLRSEK
Download sequence
Identical sequences A0A075W965 A0A101DFM8 O30124
1ma3A gi|11497732|ref|NP_068953.1| 1ma3_A 1s7g_A 1s7g_B 1s7g_C 1s7g_D 1s7g_E 1yc2_A 1yc2_B 1yc2_C 1yc2_D 1yc2_E 4twj_A WP_010877626.1.27515 WP_010877626.1.34637 WP_010877626.1.46508 224325.AF0112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]