SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101QD48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101QD48
Domain Number 1 Region: 8-287
Classification Level Classification E-value
Superfamily LigB-like 2.88e-42
Family LigB-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A101QD48
Sequence length 308
Comment (tr|A0A101QD48|A0A101QD48_STRCK) Catechol 1,2-dioxygenase {ECO:0000313|EMBL:KUN27736.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_14005 OC=Streptomyces.
Sequence
MGEIVGAGLLAHVPTIVLPRETRLELNEGKEITLVTGLEQLREDVFERDDYDTVVVLDSH
WATTVEFVVTAQGRRAGLFTSEELPRGMCRMPYDFPGDPELARNIASFADRHGTWITAID
DEYLPVYYATINLWKFLGEGLPDKRWVTIGVCQTGDMEDHLRLGRALADGIAATPGRRVL
LIASGALSHTFWPLRELRDHESSDPAHIFTPEAREADCERIAWFKEGRHDKVLDTMDEFW
KYRPEARFFHYLMMAGALGEQACVARARQYGEYENSIGTGQVHLWFDRPADGWTGTGLPA
PRTPHSRI
Download sequence
Identical sequences A0A101QD48 H2JMZ5
WP_014670399.1.21199 WP_014670399.1.28171 WP_014670399.1.57224 gi|474980083|ref|YP_007690549.1| gi|386837874|ref|YP_006242932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]