SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101QMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101QMF7
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-16
Family Prokaryotic proteases 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A101QMF7
Sequence length 581
Comment (tr|A0A101QMF7|A0A101QMF7_STRCK) Uncharacterized protein {ECO:0000313|EMBL:KUN32596.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_03475 OC=Streptomyces.
Sequence
MMRGAAWQARIACGDAVGAGFLVTGRRLLTCAHVVRWSDRAAVTVTFPHARELGALSASV
VAHGGWAGGVTDPGDVAVLELDRDVPLAPAGFAPPDTAYTEPYPRLVAYGFPEGYDEGTL
AECQPVSGQLIAGEWLELVAWQGHGQPLVDGFSGAAATLPDGRVAGMVTAAVGSSPDVRK
GRMLPLDVLARYWPELGELVPTPGHRDDARRRLYALLRRAAAAAGPVGDPNRLYVDAVGA
FGPPLPPGGFPSLWDAAAYVQWEVPDPQAVSRFADRLLELLDPEAVSRAPAAPDTPAPAG
TPAAPAWSPVVVEIDHSGAGPDQVTVEVSAYRDGRRRPVGARRLPRTGVRAYVQSRIDEA
VAHLAPDADELVTFVLPREWLNEAVAHWECGADDSTPLGCAYPLVVTDRARHHSGRLRHQ
LRKKWQKLDSGGGVEVHRVECGTRERPPSLRKRLWDGDAGVAGYAAPPAAARQHFEVGLT
VPVPVLLWPRTGSPCAGHEEASGTDTAPGEPPCPGAAFLDQLAASVAGVPPAELPRHVLS
LRLTADAAEEPDRHWARDLQLLWDDPRCFPETTASLHSPVA
Download sequence
Identical sequences A0A101QMF7 H2K3H0
gi|474982217|ref|YP_007692683.1| gi|386840006|ref|YP_006245064.1| WP_014672523.1.21199 WP_014672523.1.28171 WP_014672523.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]