SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A103YM06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A103YM06
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.32e-31
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 194-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000017
Family Calsequestrin 0.076
Further Details:      
 
Domain Number 3 Region: 429-556
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000631
Family PDI-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A103YM06
Sequence length 564
Comment (tr|A0A103YM06|A0A103YM06_CYNCS) DnaJ domain-containing protein {ECO:0000313|EMBL:KVI11485.1} OX=59895 OS=Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus). GN=Ccrd_010099 OC=Carduoideae; Cardueae; Carduinae; Cynara.
Sequence
MKNSYSISIFFICLFLLVYVSVESKSLDPYKVLGVEKDASQRQIQKAFHKLSLQYHPDKN
KNKGAQEKFAEINNAYDILSDEEKRKNYDMYGDARGNPGFDGGDAQGGHSYFRSGGPGHS
RFAFRPDEWQTMGGEGGSSKSYSFSFGGGSSDSSFGFDLGDVFSNFFGGGMSGGSQFGGF
GNSGSGSSPKSLTSINSQLYKKEIIDKGVTWLLLSYKPTMSGIQHYESITEEVASSLKGA
LEVGSVNCEVDSALCKELGILPRSKPRLYVYSYKASETGSLLEYTGGGTVKDLKLFVQDH
LPKFSKRVTLAQFEATFGTVETLPKAMLLSTKKDTPVIWRALSGLYRKRFIFYDTQVQDV
SDPIAKKLGVDALPAVVGWLSNGEKQILKSGIPVKDTKSTIRDLSSLLDGFEKKNKKIAS
TQSNSDKEAVPLLTAANFDAICGEKTPVCIIGVFRSSKGREKLRTILSSVSQKSLVRRQN
VASGPRDSVSYGLLDGSTQSWFLYAFDKSGFKTADRLLIAYKPRKSKFAAFAGDITSEEV
ERFIGSVLNGDVEFSKTRQKPTPK
Download sequence
Identical sequences A0A103YM06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]