SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A117Q8N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A117Q8N5
Domain Number 1 Region: 232-447
Classification Level Classification E-value
Superfamily TPR-like 0.0000125
Family Tetratricopeptide repeat (TPR) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A117Q8N5
Sequence length 474
Comment (tr|A0A117Q8N5|A0A117Q8N5_STRCK) MFS transporter {ECO:0000313|EMBL:KUN14754.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_44305 OC=Streptomyces.
Sequence
MSREQRGPNEKLGAVLALAGISNAGLARRVNDLGAQRGLTLRYDKTSVARWVSKGMVPQG
AAPHLIAAAIGQKLGRPVPLHEIGLADADPAPEVGLAFPRDVGQAVKSATELYRLDLAGR
RAGSGGIWQSLAGSFAVSAYATPASRWLITPADSSVAREAGSAEGSGAPIKVGHSDVRKL
REAAEDARRWDSKYGGGDWRSSMVPECLRVEAAPLLLGSYSDEVGRALFGASAELTRLAG
WMAFDTGQQEAAQRYYIQALRLARAAADVPLGGYVLASMSLQATYRGFGDEGVDLAQAAL
ERNRGLATARTMSFFRLVEARAHARAGDAQAAGAALKAAEGWLERSRPGDNDPSWLGFYG
YDRFAADAAECYRDLKAPRQVRRFTEQALSKPTEEFVRSHGLRLVVSAVAELESGNLDAA
CEQGVRAVEVAGRISSARTTEYVKDLLHRLEPYGDEPRVVELRERARPLLMAPA
Download sequence
Identical sequences A0A0H4C4I1 A0A0U5M7F1 A0A117Q8N5 A0A255PJM8 H2JYS3
gi|474983261|ref|YP_007693727.1| gi|386841050|ref|YP_006246108.1| WP_014673559.1.21199 WP_014673559.1.28171 WP_014673559.1.48160 WP_014673559.1.57224 WP_014673559.1.58886 WP_014673559.1.87246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]