SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A117QJL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A117QJL4
Domain Number 1 Region: 56-208
Classification Level Classification E-value
Superfamily TPR-like 0.00000296
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A117QJL4
Sequence length 259
Comment (tr|A0A117QJL4|A0A117QJL4_STRCK) Uncharacterized protein {ECO:0000313|EMBL:KUN31959.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_04685 OC=Streptomyces.
Sequence
MAHTAMSGNGTTGDDPLQTAVWRLRSRACWADAAALLPADRPAPALQRAALLAERCLYTE
GGWEEAEDALRTAEAVAHSDEERGAAACERGYLAYAATLLGVRDRADEARAALGRAAALI
PPGAAGRALLDFRRGLVAQNLAGAPQAARAAFRRAHAGATANADPLLLSFTWRHLAGLAL
RDGELTEARHGFAESLRIREELGYLVGTAPALVSLADTEEEPEASRLREEARRLFRLLGG
VPTWLAQQLAPPAPGAATA
Download sequence
Identical sequences A0A0S2P8M6 A0A117QJL4
gi|474985524|ref|YP_007695990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]