SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A120E635 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A120E635
Domain Number 1 Region: 233-325
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000604
Family UAS domain 0.029
Further Details:      
 
Domain Number 2 Region: 474-557
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000362
Family UBX domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A120E635
Sequence length 632
Comment (tr|A0A120E635|A0A120E635_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KWU41885.1} KW=Complete proteome; Reference proteome OX=1305733 OS=Rhodotorula sp. JG-1b. GN=RHOSPDRAFT_27353 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSLSDEEALLGSLNASQRNSLETFAAVTNRDPHSADSLRVLQEAGWDVQAAISRVYDGAP
AYPPPQDTEEADDDDNHHDHNPPLLSAPRARSPRRRAAQTGGLGTGAIGLYYLRQVLPKL
TKLAPVQALALPLAILAYPATLLYNLGAAIVVFLARLFRLRPSSTASFRPRNPFAGAARP
RTTVSPAAAAENFVRNVEQVTALSRRQSATGSASAAASSSSGLTSRHRARGGTTGPRIPD
FYIGSYDEALRFARDEMRILMVVLTSEEHERDERFKREVLVSEVVNDLVDEERIVIWGGD
VSDRDAYQVGQTLSYISLPFVAFIALQPSGPPGLASNPATAPITSPRMRLISRLEHSPTS
PLTSTTLHAHVQTAVLPRVKPFLARLVAQRAQREADRRAREDAERRVAENARRDEEKVLA
VRRREEERQRAERARLEREERERVQRIEKEREAERARGWREHKRRELLLASGGEASPAEE
GAVRVAVRLGNGQRVMRTFAGDAPTEEVYAWTECELERDADLAARAVSSAPPPPPSADYV
QRYHFRLATTFPRQVIPLPSHLASPSTTHLNKDGDEARSDETVTVAEAFRGLGKTVNLVV
DGLETRRRMSMTSREGEESEEEEEEEEEEEEE
Download sequence
Identical sequences A0A120E635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]