SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125UP45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125UP45
Domain Number 1 Region: 74-372
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.36e-84
Family Imidazolonepropionase-like 0.0000000000563
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 3.3e-25
Family Imidazolonepropionase-like 0.0000524
Further Details:      
 
Domain Number 3 Region: 355-415
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.31e-18
Family Imidazolonepropionase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A125UP45
Sequence length 421
Comment (tr|A0A125UP45|A0A125UP45_9BACI) Imidazolone-5-propionate hydrolase {ECO:0000256|HAMAP-Rule:MF_00372} KW=Complete proteome OX=1628753 OS=Bacillus sp. LM 4-2. GN=BsLM_3980 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MPKQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYE
ADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTR
AASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVST
FMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAA
EAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFY
LGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVN
AAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNREGAIL
G
Download sequence
Identical sequences A0A125UP45 A0A164URX9 A0A1B2B897 L8ATH0 P42084
224308.BSU39370 NP_391816.1.22788 WP_003244327.1.101301 WP_003244327.1.11257 WP_003244327.1.1140 WP_003244327.1.12759 WP_003244327.1.15902 WP_003244327.1.16291 WP_003244327.1.25531 WP_003244327.1.27660 WP_003244327.1.2914 WP_003244327.1.32219 WP_003244327.1.32420 WP_003244327.1.33846 WP_003244327.1.36189 WP_003244327.1.39605 WP_003244327.1.40859 WP_003244327.1.44184 WP_003244327.1.45019 WP_003244327.1.47157 WP_003244327.1.56274 WP_003244327.1.56411 WP_003244327.1.57201 WP_003244327.1.5726 WP_003244327.1.57513 WP_003244327.1.6139 WP_003244327.1.6517 WP_003244327.1.65223 WP_003244327.1.72999 WP_003244327.1.76977 WP_003244327.1.78686 WP_003244327.1.81116 WP_003244327.1.81747 WP_003244327.1.82722 WP_003244327.1.88042 WP_003244327.1.91723 WP_003244327.1.93420 WP_003244327.1.94199 WP_003244327.1.96043 WP_003244327.1.979 gi|470164159|ref|YP_007535934.1| APC1827 NYSGXRC-9249c 2bb0A gi|402778102|ref|YP_006632046.1| gi|560130978|ref|YP_008832119.1| 2bb0_A 2bb0_B 2g3f_A 2g3f_B gi|16080988|ref|NP_391816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]