SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125YM37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125YM37
Domain Number 1 Region: 234-344
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 5.75e-22
Family Elongation factor TFIIS domain 2 0.0049
Further Details:      
 
Domain Number 2 Region: 378-417
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.68e-16
Family Transcriptional factor domain 0.0019
Further Details:      
 
Domain Number 3 Region: 68-175
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 8.76e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A125YM37
Sequence length 418
Comment (tr|A0A125YM37|A0A125YM37_TOXGG) Transcription elongation factor A TFIIS {ECO:0000313|EMBL:EPR57617.1} KW=Complete proteome OX=507601 OS=Toxoplasma gondii (strain ATCC 50853 / GT1). GN=TGGT1_293670 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MIMEGRDVDAQGPNAHSKSMESEQTSVLAGRHTDSSAAVPASSDMSERPMVSGSGTNTAA
IFATCSPLERVERILELKKVIDHAKAALEDGQQGGAPGAAVTPLLGVRDDVLEALTVLDR
VDMSRELLAKTRIGVSVGKLRTHPDSQIRSRCTQLVHKWKAGISGGGLAKENATSRPGPN
GRGQGKPPTGTLGNDTANEKAHGLSSNSSPRADEGLHGVPVDRAPEKASTAVEDYPGPAS
GDAVRDRARGFLWRALVDGMQSRRDLGADRSGETARVAAEIEKALWQEYCVRRKSTKEYN
MQLKTLKWNFADQKNPDLNLKVLCGVYTPEQLAIMSSADLASDEKKRMRELQKKESMEAC
QSDWEMKKLMEGASEGGQFPCFKCRTTKTVYFQMQTRSSDEPMTTFVTCLECGNRWKF
Download sequence
Identical sequences A0A086JU65 A0A086QP23 A0A0F7USK4 A0A125YM37 A0A125YM38 A0A139XLX1 A0A151H978 B9PY58
gb|TGVEG_014110 XP_018638613.1.89292 gb|TGME49_093670 gb|TGGT1_074060 gi|211967833|gb|EEB03029.1| gi|237841743|ref|XP_002370169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]