SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125YS68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125YS68
Domain Number 1 Region: 531-678
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.71e-25
Family Staphylococcal nuclease 0.0039
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.23e-25
Family Staphylococcal nuclease 0.0051
Further Details:      
 
Domain Number 3 Region: 169-322
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.41e-24
Family Staphylococcal nuclease 0.0075
Further Details:      
 
Domain Number 4 Region: 328-500
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.18e-21
Family Staphylococcal nuclease 0.024
Further Details:      
 
Domain Number 5 Region: 741-824
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.46e-16
Family Tudor domain 0.0025
Further Details:      
 
Domain Number 6 Region: 760-923
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000432
Family Staphylococcal nuclease 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A125YS68
Sequence length 941
Comment (tr|A0A125YS68|A0A125YS68_TOXGM) Nuclease and tudor domain-containing protein {ECO:0000313|EMBL:EPT30869.1} KW=Complete proteome OX=508771 OS=Toxoplasma gondii (strain ATCC 50611 / Me49). GN=TGME49_238050 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MASGIATVKEVVSGDTFVLVGAPKGGPPPEKRLSLASVQAPRVAMKSLSHEVQDEPFGWT
AREFMRSRLIGQQVEFKVEYAMNNKEFGTIKLRGENVACALLKQGLAKLKPNRNPPCAPD
IEELEQCQDLAEQRQLGVWATDPAAGSGTIREMKWAMNDVEFVKAFVAEHKGKKLPGIVE
YVRDGGCMRVALLLPQKENESLKVVYLPVLLSGIQCDGFKREQQEGSAEYKVVPEPFAVE
ARFFVEIRLLNRDVEVRIEGCDEYGNVNGTVYHPKGNISILLLQNGLAKIQSGSLGLTEC
GAQLSQAMREAQQKQLRKWKGWSSSTSSVDAKNYMAQVAEILSGDSVVLRLPDGRERRVY
LASIRCPRAAGVGKTASREEESIAFETKEFVRRKLVGKNVKVIVEYVREPLPSASGAALP
PASDDQGRMHFVSLWVPNSPKDTDASQTKNCQNIAELILQAGLGKTIPHRADDERATEYD
KYLELEKAAMEQKKGMHAPTQQWKVHRIIDLLGPANAQRANAYFQQLERIPKLDGVVDYV
FGPGRFKIRIPSQNIAISFVLGGIRCPQSAPRPGSFAAARPGGKPREAEPFGEEAQSFSR
ARVLQRDVQVKVESVDKGGNFIGTLWYNQGKQNLAVDLLELGFAHTVDFSLARCSLRELL
VAAENKAKAARVNIWSLPGALEAEENVAKEVEVDEVLPHVTVSHVEGVDNFFVQDPSSAD
LQSVMTTLGKYGTEGSSNLEDTYTPGGLPRKGEVVICKFSADNLWYRGRVDGRDSSGKEP
QISVFYIDFGNRETLPLHAVRRCPDTVSTNKFPPQAKQCCLSGLLPPPEMEFEAASFLDE
VTQNLVFQCKIEKIDANKKRHCILTPQEDLGTGKTGNTVNEKVLRKGLACLDKKSNTKYF
HRFQVEEEAARKAHVNVWRYGDCGGDDEDDYPSLNGRGGRR
Download sequence
Identical sequences A0A086JCD4 A0A086LJV7 A0A086PGX2 A0A125YS68 B9PNS2
gb|TGME49_038050 gb|TGGT1_052800 XP_002366497.1.89292 gi|211964161|gb|EEA99356.1| gi|237834399|ref|XP_002366497.1| gb|TGVEG_035920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]