SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A126BEE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A126BEE6
Domain Number 1 Region: 61-96,273-351
Classification Level Classification E-value
Superfamily TPR-like 0.000000198
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A126BEE6
Sequence length 492
Comment (tr|A0A126BEE6|A0A126BEE6_DROME) CG8223, isoform B {ECO:0000313|EMBL:AFH06311.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG8223 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSAEAEAIVTTATADVSSPSKTVAVEPVAADTTPDNAPAVSTEGSGKAEQERAEKILKGK
ELFSQGSRNFLVKSYDEAADELSQVCQLYEEVYGELADELGQPLLLYAKALIAMALDENK
VIDVPDEAADDDDEDVDDDEEESAEDGAAKKEEKKDTKEAANGASSSNGKELDTIKEGSD
EADSTGEAEQAQSDEKPSKKVPTGVDEVSSSNGGGGAAVNDDERPSTSNGEVTASCSNGA
APAVEEEPEEEEGVSGSLQLAWEILEAAAQIFSRQGLSGLPYLAEVQTELANIEFENGIL
EAAREDYEKALKIHGELPTRNRRALAELHYKIGLTYLMQQLNKEGATALRQSSVLIEEEI
AEIKGKDEPSERDRNNMLDLEETKQEILAKIQEIEEMQAQTIAEVRAALDSYIKPMSSGD
AAAASSSSSSSANGAASSSSSSSKGAAAASSSTISSSSAKPTDITHLIKRKKPEDPSSEA
EALCSPAKRAAV
Download sequence
Identical sequences A0A126BEE6 Q9I7K6
FBpp0081398 FBpp0081398 NP_001246993.1.81976 NP_649828.1.81976 7227.FBpp0081398 FBpp0081398 FBpp0301016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]