SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A127AXE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A127AXE8
Domain Number 1 Region: 42-246
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 9.16e-103
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000103
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-17
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A127AXE8
Sequence length 246
Comment (tr|A0A127AXE8|A0A127AXE8_9ZZZZ) Methyl coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AMM45251.1} OX=358574 OS=uncultured microorganism. GN=mcrA OC=unclassified sequences; environmental samples.
Sequence
MQIGMSFISAYNMCAGEAAVADLAFAAKHAAAIQMSEMLPARRARSPNEPGGLSFGYAAD
MTQRMRLTPEDPVWYTLEVVALGTMLYDQIWLGSYMSGGVGFTQYATAAYTNDVLDDFTY
YGYDYALNKFGADGTAPNDLATATDLATEVTLNGMESYEDYPTLLEDHFGGSQRAGIMAA
ASACTTGIATGNAQVALSAWYMSMYLHKEGWGRLVFFGYDLQDQCGATNVCSYQGDQGEC
LELRGA
Download sequence
Identical sequences A0A127AXE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]