SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131ZTG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131ZTG8
Domain Number 1 Region: 248-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000133
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 415-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000565
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000482
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 183-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 526-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 6 Region: 660-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000092
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 565-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 775-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 604-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000602
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 101-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000256
Family EGF-type module 0.028
Further Details:      
 
Domain Number 11 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000076
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 223-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000779
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A131ZTG8
Sequence length 881
Comment (tr|A0A131ZTG8|A0A131ZTG8_SARSC) Uncharacterized protein {ECO:0000313|EMBL:KPL97158.1, ECO:0000313|VectorBase:SSCA004102-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0002420 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MSDSFESGDHGSFTESLLSVTQLAIESSTLSPVSHYGIDAELKCESDSNCPKNSQCVDSF
CQCIPGHCRNSGQCLITSASEVYCFCMNNFSGPECEFKNQPCGSIYNCQNGAECVFDPSQ
NRSSCHCASGFHGDNCEYVDESKTIEGCDTLICLNNGSCSIETNGSAICICSLGFEGKTC
DRNIDDCANNPCHNGGICHDLINDYACECLHPYNGRNCTETIDPCESEPCLNNGICETSK
DLLTFNCTCPIGFRGLTCEENIDDCLGSNCTEGQICVDLLNAFECRCPLGYQGPRCQDRI
DHCQNHSCVHGHCSNNLLNYTCACEIGYEGIFCDQDIDECQQNNPCINGLCVNKNGSFQC
YCTPGFTGVHCQIDIDECLSQPCQNNGHCINLQSTYKCNCTNGYSGQNCEIEVDECKSNP
CANGGTCQDELGSFTCLCPPGIEGPQCERDIDECLNKPCQNGGTCVNQLPHYKCHCREGF
TGENCESDIDECEQNPCLNAAICINHNGSYECKCESGFEGYHCEKNIDECSSNPCQNNGK
CIDRIADFECDCSGTGFEGRFCENEFNDCQSNPCADGTLRCEDLHLNYSCVCLPGFTGRQ
CEIDIDECDNEPCQNGGTCEEKAHDFVKNYRDKYEIDELVNRVDLRYTCTCPSGFEGTNC
EINKDDCEMHNCQNGAICIDEIDSYYCKCALGFDGKHCQYLVDPCISSPCRNGATCKFQR
FIRFLGERCDRRRSCYSDCHPEFSHCVMKSHNFQLCACLPNSNGLYNRSLCDPIYDCNIA
PGLCHNGGTCTNSIGMGYYCTCPEGYEGLICEKKKRINVLIVLIASIGIALSIALLIILM
IVFRSVKRARATRGTYSPSTQEMFGNSAGEILKPPPEERLI
Download sequence
Identical sequences A0A131ZTG8
SSCA004102-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]