SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132A5D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132A5D1
Domain Number 1 Region: 350-599
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-46
Family YWTD domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 19-267
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-40
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 680-892
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-32
Family YWTD domain 0.0000776
Further Details:      
 
Domain Number 4 Region: 301-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000689
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 609-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132A5D1
Sequence length 964
Comment (tr|A0A132A5D1|A0A132A5D1_SARSC) Low-density lipoprotein receptor-related protein 6-like protein {ECO:0000313|EMBL:KPM05640.1, ECO:0000313|VectorBase:SSCA009832-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0041060 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MPSSHSSSSILYLLTVDSYIIFANRKDIRKLDENVFSSSLTGHRKAPNATVLIDQLEDAT
AIDFDYEKNLLFWTDLGFETIKGFGLDDGHIFDVITTGIESPESLACDWITKKLYWVDSE
TNHIDVSNYDGSHRTVLFWKDLDQPRTIVLVPSDGIMFWSDWGETPKIEKASMDGNHSTR
EIIIKNNISWPNGLTVDYVTKTLYFADAKLGYISSCDFEGRNFKTVVSNVSQIFALTLTG
NILYWTEMQNTNSIKNHHSFKNGIHFYDRSLDKLGVPYINPHQSLSPLGITVFDVNRQPK
SYNPCAHNNGGCSHLCLLSSNSEHYSCACPTGIKLELDGKTCHSSAQKLLLLARRLDIRR
ISLDTNDYTPVVLPIKNIKHAVTLDYDPIEGKVYWTDDELLVIKRASLNGSQLETIISTE
LMYPDGLAIDWIARNIYWTDAALNRIEAARLNGTSRKIIISKDIDQPRAIVVHPLDGIMF
WSDWGVPGKIERASLDGSDRIVIVNTSLAWPNGLAIDYELSHIYWCDAKTKAIEMSRFDG
SNRRTIAVIERSHMYDLTLMDEFIYWTDWTRRTVEKTYKLTGSEISIVIENLPDLMGLKA
VSISSPNGTNPCGDNNGNCSHLCFNRPHQRYVCGCPDGSSQLEEDGRTCTKSDSYLIFLD
KIEMNRVSLKTKKIDHLPIIDIKSASAIDIDIENEIIYWADPKNHLIARSHFDGSKFEII
LQNDLGTPQDISFDWISENLYWINSEEKRIEVSRSNGIYRKIIFQDRHSQLNSLVVNPVD
GYLFWSDRSNAGKIIISFLDGNRRKILVDSVGSAISLTIDYGEKILYWISMEYNIIMSSY
FNGNSRTALNFENSMKPISIAINDEFIYVLNQNSDLLEYFSKKNHSIKSILDQNDLYASA
NQMILFDRSNQKGWNFCADQNGGCEQLCFVKPVQKNNVHESYCGCTTHYFLDGHESKKCS
RKFS
Download sequence
Identical sequences A0A132A5D1
SSCA009832-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]