SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132A9H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132A9H3
Domain Number 1 Region: 663-799
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-34
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 2 Region: 540-661
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 3 Region: 415-541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-27
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 4 Region: 64-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000203
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 376-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000693
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 115-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000182
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 340-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000869
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132A9H3
Sequence length 817
Comment (tr|A0A132A9H3|A0A132A9H3_SARSC) Cubilin-like protein 3 {ECO:0000313|EMBL:KPM07608.1, ECO:0000313|VectorBase:SSCA003140-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0061070 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MVLRSSGSGQIKINENRINTKIELLDQKLNDSIANQKKMPTLKQARRIRTLWRRVEKLEK
LLKKNECETNRCRNGATCEDGFDRYFCRCPQGFQGSDCEMDVDECSHYQGTELGCQNGGT
CLNTYGGFHCLCPPNHHGLRCNLEFNDCHNVSSHEICGDGLCINLPRSNNNEAKYRCVCY
QGFAKSSPSESAPCDIDVNECELGLDRCSRDPLVECFNTRDGYTCGSCPSGYTGDGFRCQ
MVDACTINNGGCSISPHVSCTSIGNRVICGNCPPGYVGDGYSCNIVDGDVCSTNNGGCSK
DADCIALPVISSEFRQCQCKEGFTGSGIGQNGCFPASPIICSNNSCLNGGSCLISGSNTI
CSCGQHFTGRYCESPLNPCAENPCKNNGQCVAQYETYYCLCDAEFTGRDCDQPRSLCGGE
LNSDAGVLTFPQSNYSATYSNNITCTWIIHSQSQSTKVLNITFTRFKLEKSPIGCVFDYL
EIIDGPSREYRNLGKFCGDQMPLNGNLITSFNAIYLRFRSDPSISHEGFELRWKTVDPVC
GGSFENTTGGVIESPGYPHHYPANRDCYWDVFADFGQRLQFLISDLDIEPSQNCSFDYLI
FYEGINLRAKNPDVIAKFCNWTSSSEQPIPAPIITSGSSARIHFHSDAGIHSRGFHLIFN
QVPGICGGLLTGSSGIFQSPSTSYTSQITGRTFLVYENNIVCDWLIRVQSNERISLRFLS
FALEADSLVNQSTSSSCMFDFVEIYDGNSYSSPLRARFCGRIIPPEIISTGRYLRIKFRS
DMSVTLRGFIARYQALCGGEYTGNLYFETINISLSSL
Download sequence
Identical sequences A0A132A9H3
SSCA003140-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]