SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132ABR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132ABR2
Domain Number 1 Region: 93-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family Integrin beta EGF-like domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132ABR2
Sequence length 197
Comment (tr|A0A132ABR2|A0A132ABR2_SARSC) Tenascin major / teneurin-like protein {ECO:0000313|EMBL:KPM08422.1, ECO:0000313|VectorBase:SSCA002980-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0069390 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MSGICICGKGWKGSDCSEPDNEAIHCVSDCSGHGKFDPKQQQCVCDERWSGSDCSQERCD
LDCGANGHCEDGECVCDDGWSGDKCLNRLCDPRCLEHGQCQNGSCICSKGWNGKHCSLVG
CLNDCSGHGDCVRQNLQSNDELSWSCVCELGYAGIDCSVALESNCDDNIDNDKDGLIDCA
DPECCQSESLSSSSCSS
Download sequence
Identical sequences A0A132ABR2
SSCA002980-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]