SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132H9W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132H9W6
Domain Number 1 Region: 80-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-32
Family Glutathione peroxidase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132H9W6
Sequence length 235
Comment (tr|A0A132H9W6|A0A132H9W6_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KWW32756.1} KW=Complete proteome OX=119219 OS=Cupriavidus metallidurans. GN=AU374_05731 OC=Burkholderiaceae; Cupriavidus.
Sequence
MPPLALLAHNGVNTRQGARQRNVEEGTPMKAYAKRWSKVAAVTAVGLIVCVSMGAVGHES
DDPHSHHEMKREMHTSTVDYRLPPVTLVRDDGQAVSLANELDDGRPVVLTFIYTTCTSIC
PVISQTLSQLQAELGPDRDKVHLVSISIDPEHDTPGRLREYAAKFGAGPEWQHYTGAVSA
SVAAQKAFNVYHEDKMNHSPVVLLRAAPGKPWLRIDGFATADEILHAYHHLMASN
Download sequence
Identical sequences A0A132H9W6 Q1LE69
gi|94313617|ref|YP_586826.1|NC_007974 WP_011519128.1.12480 266264.Rmet_4695 gi|94313617|ref|YP_586826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]