SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132HIX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132HIX5
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-52
Family NQO2-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132HIX5
Sequence length 168
Comment (tr|A0A132HIX5|A0A132HIX5_9BURK) NADH-quinone oxidoreductase subunit 2 {ECO:0000313|EMBL:KWW36625.1} KW=Complete proteome OX=119219 OS=Cupriavidus metallidurans. GN=AU374_02685 OC=Burkholderiaceae; Cupriavidus.
Sequence
MTMLSAEALKEIDRAIAKYPADQKQSAVMAALAVAQGEVGWVSPEVMQFVASYLEMPPVW
VEEVATFYNMYDTKPVGKHKLAVCTNLPCALSGGERAGEYLKRKLGIDYNETTADGCFTL
KEGECMGACGDAPVMIVNNTRMCSFMSEQKIDALVEELKSEAAAKGDK
Download sequence
Identical sequences A0A132HIX5 Q1LPV9
gi|94309876|ref|YP_583086.1| 266264.Rmet_0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]