SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A137Q6N8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A137Q6N8
Domain Number 1 Region: 439-481,517-553
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000207
Family Ubiquitin-related 0.07
Further Details:      
 
Domain Number 2 Region: 202-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000179
Family Thioltransferase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A137Q6N8
Sequence length 589
Comment (tr|A0A137Q6N8|A0A137Q6N8_9AGAR) UBX domain-containing protein 10 {ECO:0000313|EMBL:KXN82918.1} KW=Complete proteome; Reference proteome OX=1714833 OS=Leucoagaricus sp. SymC.cos. GN=AN958_02001 OC=Leucoagaricus.
Sequence
MSNLTDSQRRALDQLRELTNGGSDEVSIGVLESVDWNVERAAEAIFGGGPSPSNSPPTPP
PAPKTPMETFEVDDSAQNRNQNTGGSSIIYTFTRPIFSLLAVPLHILGSVFRFIFNILRI
PVPQFRFSTLNFYRPLRPRPTHRGGPDKWVVELEEELGAVCIGRLRGPRGSASTSGVEAG
PSRLTARNTQPDDPAEGKKLLPDFIISSYEEFLRTCQRELKVGCIILITEEHDDTTEFKR
ATLTNSDFVKALYNNNILVWGGDVRDIEAWNASEKLQATTYPFIAFVALQPRRTPPSSSS
RLSNSQQPVLTVLSRHQGRPYPSGTGPTSTQAILDHLDRQLLPRVSPFLERLRAEQRERE
RDRRLREEQDRAFQEAARRDKERIEARIAVERAEAEAKRRTEEEARATAIKREQEIAAAK
RREELRMNWRRWTRKTIAEPLSKTNGSLRIAIRLTTGTRLVQSFAPATSLTALYAYVDSQ
LIPSHFEPHDDPSTPPEDSATGEQAIEAQIHATGSAADWWGFQLATAYPRSEIPWKSGVQ
LGDLSVLKGGGQVVVEMLGSPHSSTERNNGRGSGGDSDDDDYKTESDEE
Download sequence
Identical sequences A0A137Q6N8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]