SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139XP63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139XP63
Domain Number 1 Region: 303-519,551-594
Classification Level Classification E-value
Superfamily vWA-like 8.89e-48
Family Trunk domain of Sec23/24 0.00026
Further Details:      
 
Domain Number 2 Region: 44-75,163-212,600-708
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.7e-46
Family beta-sandwich domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 3 Region: 218-302
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.32e-25
Family Zn-finger domain of Sec23/24 0.0004
Further Details:      
 
Domain Number 4 Region: 838-989
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.02e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139XP63
Sequence length 1019
Comment (tr|A0A139XP63|A0A139XP63_TOXGO) Putative transport protein Sec24 {ECO:0000313|EMBL:KYF40583.1} KW=Complete proteome OX=1074872 OS=Toxoplasma gondii ARI. GN=TGARI_277000 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MYTQPNLPGGTPSYPAGASQASRDAAPTQQPFYGYTSQPSPSDMRQGYANPPAQSYSNGM
PAYPSDSASVPSYPAPPLASGNPQPAAGVYASQRSAGGIPSSPFHAATPANPGAAPPPRT
AYYPSGVQSSGYAGYGAAASGVSHSAALPADSGAYASTGSAAQQVLQEIQQFNSPRYFTR
ASVARVPHSSSLQQKLHLPIGLFIRPLAPIRPGSPTVPSVNFGNCGVVVRCKRCRTYINP
FVHWEAHGRRWSCNLCGYVNDTPQFYMRGLDEKGKREDRFERAELSMGSVEFVAPADYMI
RPPQPPAYLFLIDVSATAVASGLVESACAGIRAALTSGKLPGCTDSGAGRGDSRTMVGIV
TYDSAVHFYALGSASGGGKRRPQVLVMPEIDDVFLPLSDDLFVNFAENRDAVLEALDTIP
SLWRSNGCIDNCMGSAVKAALLVMKHVGGKILLFASFPPTVGALVTKRSGGLAGADGAGT
DGGSRQQPDREVELLKPASEAYQQFAQQLTQSQVSVDLFIAPSSCASPAAGNVPPTGTYA
GGKPGSGAPGLVTAPYCDLATILPLAELTGGEVRYYSAFSRLQHSQQLENDIVHIITRTT
GWEAVMRIRVSRGWKISARHGRFFLRGTDLFVLPTVNADSTFSILMELDEQAGAGGPGNA
LVTPPSGGDNVVAVQAALLYTNSDGERRIRVHTFCMPVSQNIQDIVSSMDPEVVTCLLIQ
QAIDQSLRSKIADGRAFLQTSCSQLLSVLHSVGSSTQLAASYALPSLPHYGAVAAASAGN
PAGGALLEAGRLVALFILGVLKSNAFRPVKEVSTDKRVFSWSRLLALPVDRICAYVHPRM
LPLHNLSNFGGPSDRVLDGQEEVILPPALRLTAEEMTQDGAYLLENGEEMLLWIGRSISP
QWLASVFGAHSLDCVHPDVAATSIGDSQDPVGLRVRAVVQSVQGEHLCNAMRLLVIRQGD
PSEQKFFAQLMEDRVPSLLLTFAEFLQKVDMRSQLQAPAPPMIPAAGGAAPPLQQPRMY
Download sequence
Identical sequences A0A139XP63 A0A2G8XQT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]