SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140B4A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140B4A4
Domain Number 1 Region: 62-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-32
Family Thioltransferase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A140B4A4
Sequence length 170
Comment (tr|A0A140B4A4|A0A140B4A4_PRUPE) Glutaredoxin 33 {ECO:0000313|EMBL:ALP70524.1} OX=323852 OS=Prunus persica var. persica. GN=GRXS15 OC=Amygdaleae; Prunus.
Sequence
MSRPLSKLLFKGISGFPAACSSKIVSGSFYQNGMRYSTSVPNDSDTHDDFKPANKFDGSG
LSLKELVEQDVKDNPVMLYMKGVPEVPQCGFSSLAVRVLKQYAVPLSARNILEDPELKTA
VKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKDIAVNQEKSA
Download sequence
Identical sequences A0A140B4A4 M5VNI6
ppa012405m|PACid:17658440 ppa012432m|PACid:17658441 XP_007201252.1.23749 XP_007201253.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]