SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140T9R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140T9R5
Domain Number 1 Region: 1581-1823
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 920-1053
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 480-596
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 591-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 770-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 361-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000455
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 196-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 160-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 680-805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 11 Region: 1049-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1255-1286
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 13 Region: 238-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000292
Family EGF-type module 0.028
Further Details:      
 
Domain Number 14 Region: 316-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000879
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 812-936
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000113
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 33-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000534
Family EGF-type module 0.025
Further Details:      
 
Domain Number 17 Region: 68-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000645
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 1218-1248
Classification Level Classification E-value
Superfamily Notch domain 0.0000114
Family Notch domain 0.0065
Further Details:      
 
Domain Number 19 Region: 122-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  A0A140T9R5
Domain Number - Region: 1177-1206
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1091-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1136-1174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 628-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A140T9R5
Sequence length 2005
Comment (tr|A0A140T9R5|A0A140T9R5_HUMAN) Neurogenic locus notch homolog protein 4 {ECO:0000313|Ensembl:ENSP00000410674} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NOTCH4 OC=Catarrhini; Hominidae; Homo.
Sequence
MQPPSLLLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFL
GETCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQL
EDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQI
QCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPC
PPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTY
TCLCPETWTGWDCSEDVDECEAQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDD
CIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLC
LCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNE
CLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCI
CLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPC
PVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGC
APPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCP
TGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFN
GGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTG
GSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVS
SLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAP
GYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPT
GTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKG
FEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPS
PCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNW
DGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQY
CHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARV
LSLTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLS
AGFVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGT
APPANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPH
RRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGC
GALPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEP
LLDGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAAD
AREVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTAL
HWAAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQ
AGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGAL
PRCRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSA
GMRGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPER
GSPQLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences A0A140T9R5
9606.ENSP00000410674 ENSP00000410674 ENSP00000449920 ENSP00000410674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]