SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140VJY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140VJY7
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.83e-29
Family Txnl5-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A140VJY7
Sequence length 123
Comment (tr|A0A140VJY7|A0A140VJY7_HUMAN) Testicular tissue protein Li 214 {ECO:0000313|EMBL:AEE61124.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A140VJY7 A0A2I3H5Q4 G3QKM5 H2QC11 Q9BRA2
ENSPTRP00000014752 ENSP00000250101 ENSPTRP00000014752 ENSNLEP00000011250 NP_116120.1.87134 NP_116120.1.92137 XP_003274631.1.23891 XP_003810187.1.60992 XP_004058471.1.27298 XP_511988.2.37143 1wou_A 9598.ENSPTRP00000014752 9606.ENSP00000250101 ENSP00000250101 gi|14249348|ref|NP_116120.1| ENSNLEP00000011250 cath|current|1wouA00/4-122 ENSP00000250101 ENSGGOP00000003003 1wouA ENSGGOP00000003003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]