SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140VK72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140VK72
Domain Number 1 Region: 33-215
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.59e-52
Family Actin/HSP70 0.00001
Further Details:      
 
Domain Number 2 Region: 220-319,363-446
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.08e-43
Family Actin/HSP70 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A140VK72
Sequence length 471
Comment (tr|A0A140VK72|A0A140VK72_HUMAN) Testis secretory sperm-binding protein Li 199a {ECO:0000313|EMBL:AEE61209.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPD
ENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYP
FKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDL
KQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQG
GMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLT
LHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVL
FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE
FFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN
Download sequence
Identical sequences A0A140VK72 P48723
NP_008879.3.87134 NP_008879.3.92137 gi|48928056|ref|NP_008879.3| ENSP00000285667 9606.ENSP00000285667 ENSP00000285667 ENSP00000285667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]