SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142F4B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A142F4B0
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-33
Family Duffy binding domain 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A142F4B0
Sequence length 245
Comment (tr|A0A142F4B0|A0A142F4B0_9APIC) Duffy binding protein 2 {ECO:0000313|EMBL:AMQ67639.1} OX=5827 OS=Plasmodium cynomolgi. GN=DBP2 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
SKVVETNLRSIFGTGENAQLHRKQWWNECKKEIWREIMSSVKKKLKGNSAWICEKDVAVN
VEPQIYRWIREWGRDYILELPKELQKLKEKCDRKFYYTDINVCNVFPCKNACILYDQWIT
RKKKQWDLLSNKFISVKKEQNIQTADIVTAYDILKQELDGFNDVAFENEINQRDNAYIDL
CVCAAKKNTQKVLTNVENAAKSKAPNSNPKIQVVYSSKQEKVQGDSAHGNVNGGANNSTT
GKAVT
Download sequence
Identical sequences A0A142F4B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]