SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146GEX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146GEX5
Domain Number 1 Region: 536-582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 493-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000485
Family EGF-type module 0.026
Further Details:      
 
Domain Number 4 Region: 117-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146GEX5
Sequence length 582
Comment (tr|A0A146GEX5|A0A146GEX5_SPHZY) C8b1 {ECO:0000313|EMBL:BAU69629.1} OX=195335 OS=Sphyrna zygaena (Smooth hammerhead) (Squalus zygaena). GN= OC=Carcharhinidae; Sphyrna.
Sequence
MLQSVNYILLYAALSITQPNGYCIEILAESNDQSNAVNINKVGGHWKRSLRNPSQPIDCV
HSSWSSWSICDPCQNKRYRYARLEVPSQFGGASCESFDREEESCTAGACRTRNLCEGFVC
ADTGRCVGRRLLCNEDDDCGDQSDEKGCRRVSNACSRDTEQYWAVQHIGSGYNILTETLE
GAVLDNRYYGGSCAPYYMNNVRFRKPYNLEFYSPETEGRFELSLTEHESFSNFTHSRFES
KNKNFGFSFGISLPTIFEIGVSYNSNNFKKMMQKLLKNSASKQSLFHAQFSLQVARFKMK
RRDLMLHYDFFQRVKQLPTAYNYGEYREIFKDYGTHYMSEGVLGGTYEYIWEVDSKKMEK
DGYSLNDARDCAKGGFNVGANIRVYVAVDIKVALCDGLLNVNGEGISQSNYTEDFIVFVR
GGASEHVTALAHKQLPTVELMQEWGDAVEYNPEVIKFKPAPLYELVTSNTFQNAVRIKAN
MRQALEEYLIESSSCRCAPCQNNGVVVLKGTKCVCICPAGFRGTACEITTREDIAVDGKW
SCWSSWSGCRNRQRTRTRQCNNPPPEKGGQMCKGDNQHIISC
Download sequence
Identical sequences A0A146GEX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]