SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146GF08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146GF08
Domain Number 1 Region: 107-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 44-91
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000126
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 498-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000261
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 548-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146GF08
Sequence length 591
Comment (tr|A0A146GF08|A0A146GF08_SPHZY) C9 {ECO:0000313|EMBL:BAU69633.1} OX=195335 OS=Sphyrna zygaena (Smooth hammerhead) (Squalus zygaena). GN= OC=Carcharhinidae; Sphyrna.
Sequence
MTTIPAIISFYGFLFASVSLLSNSEGKERSQRRVERDVNTPAKIPCQLTPWNQWSSCQPC
LGRRYRSRSIIHFGQFGGRTCSDTLSDEESCPVIGNCEEPPINCGINFQCDSGQCIPRRL
KCNEDNDCGDYSDEDDCESYRSPCRKLLEPLEIGNIAGSGVNIFGMEPRRSPFNNKLYYG
QCNHVYDGNRRMYFRIPWNIIQFNYQTQAEQAFVTEMYESSSEVVTKIMEESTSNFNIGL
SLRTSTKNLNASLEAKFNLNKTRNLEILLSHNQSQTNEYFRVKGQIQLAKFHIRRNRYKL
DEDFVIDLKNLPLEYEKGVYFKILEDYGTHYTSSGTLGGDYQMVYVLDKSEMAKEHINNE
KVKECLGFHANFNFRQNIIKSEDKTNTHAHFNINDDKCKIVTRAYSSLKTEKPLIKDVLS
FVTGGDTVFLTRLNVMLSEGNRPIDASIYTDWASSLIHSPALVRQQNVPIYDLVPSEMRS
ASVIRHNLERAISDYEAEYSVCKCGPCMNGGTVLQLDGHCRCLCSNRFQGIACETPKPLQ
TGKSGYTDGQWSCWSGWSSCTNNQRVRTRQCLGTQGGGTACPGISKGTGYC
Download sequence
Identical sequences A0A146GF08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]