SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146N7B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146N7B2
Domain Number 1 Region: 591-634
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 120-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 545-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000281
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146N7B2
Sequence length 646
Comment (tr|A0A146N7B2|A0A146N7B2_FUNHE) Complement component C8 beta chain {ECO:0000313|EMBL:JAQ26940.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MFSVMIQPGRVSSHSCLLTVALGLLLLSEFPQATASNGNSGVREGRSVGGQVVVQPVDCV
LSEWSRWSRCDTCAKKRFRYAKLERPSQFGGELCYLNGRQEESCEVPDRYTCDNVPLCEG
FLCTQTGRCVHRTLQCNGEDDCGDMSDEAGCQRVSKPCREEAEEYWGIENLAKGINVLNS
QVEGVVLDNRYYGGGCLPHYIQDVPFRKPFNLQQYTLQTGGSYDFTLESFTSYSDYMEHT
LRERTTQTSFSFGFSVPGVFSLGFNYKDSKYRKFVSTIRRASGVVSLPLTRDHPYVPPNA
SVPYDPRSRQQAYTFALWSPGEQFHSSQSGAAASQNSFIQAKAELQLARYILKSDGLVLH
PEFLQRLRSLPQAYVYGEYRQIYRDYGTHYITEATLGGDFQHTIILNKKKLEKSDYTLDQ
YKSCVQVGFKIGVTIQGVPVSVGADAGSCGGLLKEMGEDTKNGATMEDFVAVVRGGSSES
ITAFLSQKLPGPDLMRLWGEGVRFNPDFIRMTTKPLYELVTSRDFVQDASLKRNLKRALS
EYLAETSSCRCAPCHNNGVAVLKGTRCECVCPSGYTGRSCEITHSQKELGIDGSWSCWGQ
WSSCSGGRMSRSRQCNNPAPSNGGLSCTGPQQESAVQQPGTKQRRS
Download sequence
Identical sequences A0A146N7B2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]