SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146Q991 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146Q991
Domain Number 1 Region: 12-200
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.82e-33
Family Ankyrin repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 218-263
Classification Level Classification E-value
Superfamily SOCS box-like 0.000017
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146Q991
Sequence length 318
Comment (tr|A0A146Q991|A0A146Q991_FUNHE) Ankyrin repeat and SOCS box protein 6 {ECO:0000313|EMBL:JAQ52574.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MLCQEIYKKIINCRGGWGIAGTPLHAAVSKGHLSCLQVLLAHGAFVDSVDVKAQTPLFAA
VRGKYLDCVLSLLGAGASPNGSRSNNSSPVLTAAREGDAEILRQLLVHGADVNSRSKVLV
WPSCDRVSSGPLYLAAVYGHMECFRLLLLYGADPDYNCTDARFLSLVKQPKTVLEMCLRH
GCGVEYIQLLIDFGANVYLPTLIIEKSTKQNEAVELLLSERGSPKALTSQCRLAVRRHLK
SINRIHCIDELEMPSSLKHFLQHKAAPXXXXXXXXXXXXXXXXXXXXXXXXXXXAYTCLK
TAFPSSCAAAVLTFQLED
Download sequence
Identical sequences A0A146Q991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]