SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146WMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146WMJ3
Domain Number 1 Region: 22-33,60-163
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000209
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146WMJ3
Sequence length 561
Comment (tr|A0A146WMJ3|A0A146WMJ3_FUNHE) Uncharacterized protein {ECO:0000313|EMBL:JAR30237.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MDNLTPEQWREIMNKKMRFPPELLNAIHEGKIELLSGLLRTGDGIIRQLDESEDRQWREA
LNLSIRLGNEDAMDVLLQGVKFDFRQIHEALLVAVDTNQPKVVKRLLDRLDQEKGNKMDV
RSFSQAIFDRSIDDSQFAPGVTPLTLACQKDLYEIVTMLTQKGHVIPWPHKISCACLECR
NGRQYDLLKFSLSRINTYRGIASRAYLSVTSTDAMLSAFSLSKELRKLSQKEPEFKPQYL
GLEQLCQEFAVELLGMCRNQSEVTTILNSCGDESQDALDAQAFEEGIPNLSRLRLAVNYN
QKQFVAHPICQQVLSSIWCGNLAGWRGSRTAWKLLVSVGIFLTMPFLCLVYWIAPKSKPG
KIIRIPVIKFLLHSASYLWFLITLLGESITMEMYRDKFASRHQNMLHSSFHMVWVVGRSR
LSGLTSTALGGNTKPCSMSFPAGFFWYECKEVWIEGLRSYFLDWWNCLDMMVLSMYLASF
ALRVLIILKGHFLCHDQSNSDECVYFTQTVRDSWHQEDPQLISEVLFAVTSMLSFTRLAY
ILPAHESLGTLQISIGKMIDD
Download sequence
Identical sequences A0A146WMJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]