SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146WNH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146WNH8
Domain Number 1 Region: 247-385
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-35
Family cAMP-binding domain 0.0000021
Further Details:      
 
Domain Number 2 Region: 116-243
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-29
Family cAMP-binding domain 0.00000173
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146WNH8
Sequence length 392
Comment (tr|A0A146WNH8|A0A146WNH8_FUNHE) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|EMBL:JAR30784.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSIEIPVGLTELLQGYTVEVLRQRPSDLVDFAVQYFTRLRDTRSQDGSGVGGKPGKGVMF
DGEPMQTESNGEDDDDDEDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDTEPRVVHPKTD
EQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPEEHVIDQGADGDNFYVIERGVF
DIKVSGNCVGQYNNKGSFGELALMYNTPRAATIVATQEGSLWGLDRATFRRLIVKNNAKK
RRMYETFIESVPLLKSLEATERMKIVDVLGMKQFLDGERIITQGEKADCFYIVESGEVKI
MMKSKTKADHADNAEVEIARCSRGQYFGELALVTNKPRAASAYAMGDVKCLVIDVQAFER
LLGSCKEIMKRNIAHYEEQLVALFGSSMDLRD
Download sequence
Identical sequences A0A146WNH8
XP_012722214.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]