SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146XC65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146XC65
Domain Number 1 Region: 581-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 115-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 53-100
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 535-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000235
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146XC65
Sequence length 628
Comment (tr|A0A146XC65|A0A146XC65_FUNHE) Complement component C8 beta chain {ECO:0000313|EMBL:JAR38797.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MIQPGRVSSHSCLLTVALGLLLLSEFPQATASNGNSGVREARSVGGQVVVQPVDCVLSEW
SRWSRCDTCAKKRFRYAKLERPSQFGGELCYLNGRQEESCEVPDRYTCDNVPLCEGFLCT
QTGRCVHRTLQCNGEDDCGDMSDEAGCQRVSKPCREEAEEYWGIENLAKGINVLNSQVEG
VVLDNRYYGGGCLPHYIQDVPFRKPFNLQQYTLQTGGSYDFTLESFSSYSDYMEHILRER
TSQTSFSFGFSVPGVFSLGFNYKDSKYKKFVSTIRRASGVVSLPLTRDHPYVPPNASVPY
DPRSRQHAYTYAIWSPGEQFHSSPENSFIQAKAELQLARYILKSDGLVLHPEFLQRLRSL
PQAYVYGEYRQIYRDYGTHYITEATLGGDFQHTIILNKKKLEKSDYTLDQYKSCVQVGFK
IGVTIEGVPVSVGADAGSCGGLLKEMGEDTKNGATMEDFVAVVRGGSSESITAFLSQKLP
GPELMRLWGEGVRFNPDFIRMTTKPLYELVTSRDFVQDASLKRNLKRALSEYLAETSSCR
CAPCHNNGVAVLKGTRCACVCPSGYTGRSCEITHIQKELGIDGSWSCWGQWSSCSGGRMS
RSRQCNNPAPSNGGLSCTGPQQESTECF
Download sequence
Identical sequences A0A146XC65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]