SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146Y285 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146Y285
Domain Number 1 Region: 895-1005
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.025
Further Details:      
 
Domain Number 2 Region: 1001-1135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 740-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000733
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 861-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 774-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146Y285
Sequence length 1240
Comment (tr|A0A146Y285|A0A146Y285_FUNHE) Fibulin-2 {ECO:0000313|EMBL:JAR48333.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MAEAEVRLLRCILLLLLLPISLSQRDCSGVDCPLLNNCIKEELEIGACCTSCLQKGCRCE
GYEKYDCIHAGFKDGLVPEGESYFVDYGSTECSCPVGGGPISCRYIDCPNMPPNCIEISA
PENGCPQCEVIGCVHNGEKYEAGHSFHMENCMVCHCPNQGGELMCYPVPDCDVQKVHNPM
LTFLTGGGTSNGRDSYPTSFDQIPSSYHHPSGGNLPLFRTSPYDNDSDEYDYNPSDFSET
YPDLFVQPTQSSLSSNKVASTGSERSDRTSSLLSLNIQEKMELREPYRVHHHLTDNKKVT
DFASAVEQNTARSTVTATTSWQGLLHTQTPSSRSVNSYAELENPLYVHRSLGSDAFPVNN
PKSPEGNSESTLHHQRSSTTEVYHPNTLDGVTPKGSNSRINKTHLLRGTEYAPAQKGGSE
TVEFPLYMLRNMDSPDDDILRAHFPEELHEPDDKKRFVAGPKETDVPDLIRLTQTEKSHI
NFESSSPSQGNLDYQQTTMAYFNTTTTQPPSTVRLTESLPIGDLPHSPRREDLKAELKTG
EEEGRSPVLLFRPEGDSLGSSEDILQSCCDAGLRWAREKKHCNHITVHSDKHSICSVVGQ
QCCLSSVKDSRCDAGVTAARAGHHCEADVDNACTDEYQVCCSCCAIGLWIRSEGLDCNTQ
KYLSYPCGHIFLSCCKEEEGQSQLPQWRKKISRPTALPRQVSQEENSQVEEINSSTHTTA
TMTPTSETTTSSVRLHPCADESGCSQQCTAVAGQAHCSCFPGFSLMTDRRTCKDVDECMT
NTHSCRSNQRCLNTVGSFVCELQVSCPAGYQLQNGVCRDIDECMVRTHNCDEGFVCENRV
GSFHCNPKLKCISGFIQDLHGNCIDINECSSLSEPCTSGSTCINTVGSYTCQQKTLICNP
GYTSSSDGTKCVDSDECQMGTHQCGVGQICHNLPGSYRCDCQTGYRYDAFRKVCTDVNEC
WQSPRRLCAQTCENTQGSYRCSCTTGFSLALDGKNCEDVNECDNNPCSQECVNIYGSYQC
YCRQGYYLKEDRHTCEDIDECSQSIGNLCGFQCINVVGSYQCACPRNGYVTVANGRTCRD
IDECRTGTHNCSFSQTCYNLQGSFKCVSFDCPQNYKKVSPTHCERISCPTNSIDCQNSPL
RIAYHQLNLKTNVITPAQIFRMGPSQVFSGDNIVISIIKGNEEGYFSARKLNSFTGAIYL
QRKVDEPKDFLLDVEMKLLRKGTFTSFLSRIYVFITSNKM
Download sequence
Identical sequences A0A146Y285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]