SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146Y479 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146Y479
Domain Number 1 Region: 923-1033
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.025
Further Details:      
 
Domain Number 2 Region: 1029-1163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 768-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 889-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 802-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146Y479
Sequence length 1268
Comment (tr|A0A146Y479|A0A146Y479_FUNHE) Fibulin-2 {ECO:0000313|EMBL:JAR48332.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MAEAEVRLLRCILLLLLLPISLSQRDCSGVDCPLLNNCIKEELEIGACCTSCLQKGCRCE
GYEKYDCIHAGFKDGLVPEGESYFVDYGSTECSCPVGGGPISCRYIDCPNMPPNCIEISA
PENGCPQCEVIGCVHNGEKYEAGHSFHMENCMVCHCPNQGGELMCYPVPDCDVQKVHNPM
LTFLTGGGTSNGRDSYPTSFDQIPSSYHHPSGGNLPLFRTSPYDNDSDEYDYNPSDFSET
YPDLFVQPTQSSLSSNKVASTGSERSDRTSSLLSLNIQEKMELREPYRVHHHLADNKKVT
DFASAVEQNTARSTVTATTSWQGLLHTQTPSSRSVNSYAELENPLYVHRSLGSDAFPVNN
PKSPEGNSESTLHHQRSSTTEVYHPNTLDGVTPKGSNSRINKTHLLRGTEYAPAQKGGSE
TVEFPLYMLRNMDSPDDDILRAHFPEELHEPDDKKRFVAGPKETDVPDLIRLTQTEKSHI
NFESSSPSQGNLDYQQTTMAYFNTTTTQPPSTVRLTESLPIGDLPHSPRREDLKAELKTG
EEEGRSPVLLFRPEGDSLGSSEDILQSCCDAGLRWAREKKHCNHITVHSDKHSICSVVGQ
QCCLSSVKDSRCDAGVTAARAGHHCEADVDNACTDEYQVCCSCCAIGLWIRSEGLDCNTQ
KYLSYPCGHIFLSCCKEEEGQSQLPQWRKKIFFFFFFFFFFFFFFFFFFFFFFFFFFFLS
RPTALPRQVSQEENSQVEEINSSTHTTATMTPTSETTTSSVRLHPCADESGCSQQCTAVA
GQAHCSCFPGFSLMTDRRTCKDVDECMTNTHSCRSNQRCLNTVGSFVCELQVSCPAGYQL
QNGVCRDIDECMVRTHNCDEGFVCENRVGSFHCNPKLKCISGFIQDLHGNCIDINECSSL
SEPCTSGSTCINTVGSYTCQQKTLICNPGYTSSSDGTKCVDSDECQMGTHQCGVGQICHN
LPGSYRCDCQTGYRYDAFRKVCTDVNECWQSPRRLCAQTCENTQGSYRCSCTTGFSLALD
GKNCEDVNECDNNPCSQECVNIYGSYQCYCRQGYYLKEDRHTCEDIDECSQSIGNLCGFQ
CINVVGSYQCACPRNGYVTVANGRTCRDIDECRTGTHNCSFSQTCYNLQGSFKCVSFDCP
QNYKKVSPTHCERISCPTNSIDCQNSPLRIAYHQLNLKTNVITPAQIFRMGPSQVFSGDN
IVISIIKGNEEGYFSARKLNSFTGAIYLQRKVDEPKDFLLDVEMKLLRKGTFTSFLSRIY
VFITSNKM
Download sequence
Identical sequences A0A146Y479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]