SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146Z8E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146Z8E0
Domain Number 1 Region: 880-1157
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000524
Further Details:      
 
Domain Number 2 Region: 24-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-38
Family MAM domain 0.00000746
Further Details:      
 
Domain Number 3 Region: 1152-1295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.25e-31
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0013
Further Details:      
 
Domain Number 4 Region: 387-590
Classification Level Classification E-value
Superfamily Fibronectin type III 5.61e-27
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 282-457
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000116
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146Z8E0
Sequence length 1338
Comment (tr|A0A146Z8E0|A0A146Z8E0_FUNHE) Receptor-type tyrosine-protein phosphatase U {ECO:0000313|EMBL:JAR62674.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MYSAALLLMLAARMCADGVERPTAGCTFDEDSDSGLCEYRQGQEDDFDWQLIKTFNWPHP
TADLLPGSFMMVNSSQHLGGQRAQLYLLPLSENDTHCIQFSYFLYSRDGHSPGALQVYIR
VNGGPKGSAVWNISGSQGRQWHQVELAVSTFWPSDYQVIFEATVSDERQGYIALDDTVLL
NYPCYKVPHFSRLGDVEVNAGQNASFQCVATGKVSETEPFVLERRNSVVLDTSWLSRLSH
KRLMATFQVEAQRGEQDLYRCITLSPRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYLI
IQLNTNSIVGDGPVIRREIQYRASQSAWKETHVVGSLTYKVWHLEPDTEYYISVLLTRPG
EGGTGAPGPPLVSRTKCAEPMRALRGLTATEIQPRLLALQWEPLGYNLTRCHTYTLYLCY
RYSMPTGSSGGNNATVRECLSVDRNTSRFTLRDLPPFRAVHVRLALANPEGKKESREVTF
QTEEDIPGGIAPESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSVESSDPGINVPGP
RRTVSKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPS
PLSESESTITVLLRPALGRGAPVSAYQVVVVEEDGSRQVRRRKRRRELGTEDCFPTANSH
SEAQVKGAQHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLIYFQATSNFK
GETRINCIRIARKAACKDSKRALEVSQHAEDMGLILGACAGGLVVLILLLGAIVIIVKKG
RDFYSYPYYPRKKVAINKAAMSYRQEKSRKLSPLDCSMTEQSTLQQDDRMAHSFMDAHGC
NARNEQRSSVNESSSLLGGSPQRHCRRKSSPYHTGQLHPAVRVADLLQHINQMKTSEGYG
FKQEYESFFDGWDATKKKDKTKGRRDSLLSPDRHRVKLHSLLADPSSDYVNANYIDIRIN
REGYQRSNHFIATQGPKQEMIYDFWRMVWQENCFSIVMLTKLVEVGRMKCCKYWPDDTEL
YGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVCQFHLTSWPEHGVPYHATGLLAFLR
RVKASTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMI
QTEEQYVFIHDAILEACLCGETAIPVSEFALTYKEMLKVDCQSNTSQLREEFQTLNSVTP
HLDVEECSVSLMPRNREKNRSMDVLPPDRSLAFLVTTEGESSNYINAALADSFLRPAAFV
VTPHPLPGTTTDFWRLIYDYSCTSVVMLNQLNQSNSAWVRKKKTLSLIYLMVCVLLLIRC
FIVYYFFYYFLLGNVFHV
Download sequence
Identical sequences A0A146Z8E0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]