SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A147A8J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147A8J6
Domain Number 1 Region: 24-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.07e-34
Family Ankyrin repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 256-301
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000235
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A147A8J6
Sequence length 345
Comment (tr|A0A147A8J6|A0A147A8J6_FUNHE) Ankyrin repeat and SOCS box protein 12 {ECO:0000313|EMBL:JAR74836.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
HIEGPMHRLRTAEEEEHSSEISQLRQAVLQNDARLLDEMLCQEIYKKIINCRGGWGIAGT
PLHAAVSKGHLSCLQVLLAHGAFVDSVDVKAQTPLFAAVRGKYLDCVLSLLGAGASPNGS
RSNNSSPVLTAAREGDAEILRQLLVHGADVNSRSKVLVWPSCDRVSSGPLYLAAVYGHME
CFRLLLLYGADPDYNCTDARFLSLVKQPKTVLEMCLRHGCGVEYIQLLIDFGANVYLPTL
IIEKSTKQNEAVELLLSERGSPKALTSQCRLAVRRHLKSINRIHCIDELEMPSSLKHFLQ
HKAGPRPRPLNLVLCLFLLHFNWLLAYTCLKTVFSLFMRCCCSDF
Download sequence
Identical sequences A0A147A8J6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]