SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A149NML2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A149NML2
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.66e-59
Family Glycosyl hydrolases family 16 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A149NML2
Sequence length 264
Comment (tr|A0A149NML2|A0A149NML2_BACFG) Uncharacterized protein {ECO:0000313|EMBL:KXU49860.1} KW=Complete proteome OX=817 OS=Bacteroides fragilis. GN=HMPREF2533_00629 OC=Bacteroides.
Sequence
MKTKTFLALFCLLCISSGFSSCQRHSSDQWKLVWEDNFDQKTGFDPQVWSKIPRGKSDWN
NYMTDFDSCFDMRDGNMVLRGIINHSQPNDTAPYLTGGIYTKGKKAFSNGRLEIRAKLNG
ARGEWPAIWMLPIDAPWPMGGEIDIMERLNHDTIAYQTIHTNYTYNLGIKDNPLSHSVGA
INPDDYNVYSVEMYPDSIAFYINDTHTFTYPRIETDKEGQFPFDQPFYLLIDMQLGGSWV
GAVDPKELPVEMYVDWVRFYQKEK
Download sequence
Identical sequences A0A015TDH9 A0A015UZK7 A0A015V2S3 A0A0E2SNK0 A0A139TFW4 A0A149NML2 Q5L7Y7
NYSGXRC-11268a WP_010993725.1.10405 WP_010993725.1.21908 WP_010993725.1.23698 WP_010993725.1.30158 WP_010993725.1.35818 WP_010993725.1.37052 WP_010993725.1.37988 WP_010993725.1.38746 WP_010993725.1.39779 WP_010993725.1.53885 WP_010993725.1.56204 WP_010993725.1.58084 WP_010993725.1.60854 WP_010993725.1.6251 WP_010993725.1.63590 WP_010993725.1.7580 WP_010993725.1.91045 WP_010993725.1.95750 272559.BF4139 gi|60683560|ref|YP_213704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]