SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150G6A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150G6A7
Domain Number 1 Region: 213-288
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 133-205
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 305-399
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 466-504
Classification Level Classification E-value
Superfamily WW domain 0.0000000092
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A150G6A7
Sequence length 506
Comment (tr|A0A150G6A7|A0A150G6A7_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ45354.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_55g260 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MADETAQLGVEPAQAEQHVSYSDHHVEHVEQHQDHPAYQNGESEAAPGTEPPKDPAQADT
TPEAIAALEAGKNRALELASLFAAQAGHAPDSNKRKLEEGADGPDFKRAAGEGGVSSRFS
AVDILPTSALLLGDGSSVTEVVMCPPDKVGRVIGRAGATIRDLEAGTGTRIQVDHKAAGE
KPVTISGKREDVERAVKTVQDLIAGTTGTDASQPVAGEVQKTLECPAGIVGRVIGRGGET
IRSLQQASGAHILVNQDFPEGQPREIVITGTQDSVDRAHNMVTELIGGANVSTQTVIQRF
GVGSTEVLECPKAMVGRIIGKGGETIKDLQKRFSASIQIDQSSTPCKVTITGPGHMISSA
RRAVEELIRSTHGGLGGPSSGPPFNSPYGQQPYGGGPGGPYGGYGGYGMPAPAYGAPGGY
PYGYSPYPAAVPPYGGYGGYGAPGAQPDMSAYQGYGQAASANQQQPQQSSAKPASVWQAL
QDDQARTYYYNTQTGVSQWEKPADMP
Download sequence
Identical sequences A0A150G6A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]