SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GPX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GPX3
Domain Number 1 Region: 117-185
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Domain Number 2 Region: 377-516
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000127
Family Ankyrin repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150GPX3
Sequence length 564
Comment (tr|A0A150GPX3|A0A150GPX3_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ51843.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_11g282 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MLQPCGELRSLLWTPGLAERVACFLDSNDVPCGLRLVNKATAALFSRDHDLIVRLARPVS
HTEFARRWGAHGALMSWTLAERRRLMCLIAASGVLPNLELVADAAGCPLPADVWTAASHS
GHLHVCEWLLRRGCPERGAALPAAAAAGHLAVCDWLLTRAGGLWCNAALVAAAQAGQLEA
LLWLLLRRNPGPRVARGPSGWPLLVSILGAVAEGCDLATLRCLHLQLLGSAGATDGPTGA
CHTDAGTSDFLRELGASILTALRPSDQPQEAVAAAAAASSGAGRQLALTHILAHAAGSPT
PDWAAKVEWLEAQGCPRCAEALLIAAGRPDALERLAWLRRRGYPVSGEAVARAAAGPHGA
AAIAAVRYLLAQGARAGIDAAVAAVRAGHLAAMEALREANCPVASHRALCEAASRGDLEA
VAWLVDEAGAAGLLDTDVFEWAARSGRVELLAWLRRRGCPCNSGDLFEAAADAGCVAALE
WLASAEYGMPDDGRPFLAAGANGDEAALRCLCRLGCPWGPSGEVFTTIVRSGARLALLAG
LVEAGCPVDWAPAGGQSSKSAGFK
Download sequence
Identical sequences A0A150GPX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]