SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151H773 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151H773
Domain Number 1 Region: 303-519,551-594
Classification Level Classification E-value
Superfamily vWA-like 8.89e-48
Family Trunk domain of Sec23/24 0.00026
Further Details:      
 
Domain Number 2 Region: 44-75,163-212,600-708
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.7e-46
Family beta-sandwich domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 3 Region: 218-302
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.32e-25
Family Zn-finger domain of Sec23/24 0.0004
Further Details:      
 
Domain Number 4 Region: 838-989
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.15e-19
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Weak hits

Sequence:  A0A151H773
Domain Number - Region: 791-837
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.000128
Family Helical domain of Sec23/24 0.012
Further Details:      
 
Domain Number - Region: 710-770
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.00162
Family Helical domain of Sec23/24 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151H773
Sequence length 1019
Comment (tr|A0A151H773|A0A151H773_TOXGO) Putative transport protein Sec24 {ECO:0000313|EMBL:KYK65164.1} KW=Complete proteome OX=1130821 OS=Toxoplasma gondii TgCatPRC2. GN=TGPRC2_277000 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MYTQPNLPGGTPSYPAGASQASRDAAPTQQPFYGYTSQPSPSDMRQGYANPPAQSYSNGM
PAYPSDSASVPSYPAPPLASGNPQPAAGVYASQRSAGGIPSSPFHAATPANPGAAPPPRT
AYYPSGVQSSGYAGYGAAASGVSHSAALPADSGAYASTGSAAQQVLQEIQQFNSPRYFTR
ASVARVPHSSSLQQKLHLPIGLFIRPLAPIRPGSPTVPSVNFGNCGVVVRCKRCRTYINP
FVHWEAHGRRWSCNLCGYVNDTPQFYMRGLDEKGKREDRFERAELSMGSVEFVAPADYMI
RPPQPPAYLFLIDVSATAVASGLVESACAGIRAALTSGKLPGCTDSGAGRGDSRTMVGIV
TYDSAVHFYALGSASGGGKRRPQVLVMPEIDDVFLPLSDDLFVNFAENRDAVLEALDTIP
SLWRSNGCIDNCMGSAVKAALLVMKHVGGKILLFASFPPTVGALVTKRSGGLAGADGAGT
DGGSRQQPDREVELLKPASEAYQQFAQQLTQSQVSVDLFIAPSSCASPAAGNVPPTGTYA
GGKPGSGAPGLVTAPYCDLATILPLAELTGGEVRYYSAFSRLQHSQQLENDIVHIITRTT
GWEAVMRIRVSRGWKISARHGRFFLRGTDLFVLPTVNADSTFSILMELDEQAGAGGPGNA
LVTPPSGGDNVVAVQAALLYTNSDGERRIRVHTFCMPVSQNIQDIVSSMDPEVVTCLLIQ
QAIDQSLRSKIADGRAFLQTSCSQLLSVLHSVGSSTQLAASYALPSLPHYGAVAAASAGN
PAGGALLEAGRLVALFILGVLKSNAFRPVKEVSTDKRVFSWSRLLALPVDRICAYVHPRM
LPLHNLSNFGGPSDRVLDGQEEVILPPALRLTAEEMTQDGAYLLENGEEMLLWIGRSISP
QWLASVFGAHSLDCVHPDVAAASIGDSQDPVGLRVRAVVQSVQGEHLCNAMRLLVIRQGD
PSEQKFFAQLMEDRVPSLLLTFAEFLQKVDMRSQLQAPAPPMIPAAGGAAPPLQQPRMY
Download sequence
Identical sequences A0A086J794 A0A086JLZ1 A0A086JPW8 A0A086PGE0 A0A086PPF7 A0A125YZT0 A0A125YZT1 A0A151H773 B9PS36
gb|TGGT1_105320 XP_002370447.1.89292 gi|211968111|gb|EEB03307.1| gi|237842299|ref|XP_002370447.1| gb|TGVEG_027670 gb|TGME49_077000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]