SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151L660 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151L660
Domain Number 1 Region: 451-735
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-65
Family Duffy binding domain 0.000000447
Further Details:      
 
Domain Number 2 Region: 149-421
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-43
Family Duffy binding domain 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151L660
Sequence length 1294
Comment (tr|A0A151L660|A0A151L660_PLARE) Erythrocyte binding antigen-140 {ECO:0000313|EMBL:KYN94455.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRSY57_1300500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGYFNIYFLIPLIFLYNVIGINESIRGRTFYNRQDESSDISRVKSPELNNNHKTNIYDS
DYKDVKNKLINSFVENRSVKKKRSLGFINNKTRSYDIIPPSYSYRNDEFNSLSKIEDNSG
NTYSNNFGNTSEISIGKDNKQYTFIQKRTHLFACGIKRKSIKWVCRENSEKITVCVPDRK
IQLCIANFLNSRLETIEKFKEIFLISVNTEAKLLYNKNEGKDPSIFCNELRNSFSDFRSL
FIGDDMDFGGNTDRVKGYINMKFSHYYMEENVEKLNNIKKEWWEKNKENLWNHMIVNHKE
NISNECATIPEEEPQINGWIKEWNENFWMEKERLFLNIKDKCVENKKYEACFGGCRLPCS
SYTSFMKKSKTEMEVLTNLYKNKNSGEDKNKFLDDLFKKNNKTNLDDFFKNEKEYDDLCD
CRYTVTIIKSFLNGPAKNDVDTASKINANDLREFGCNYKSNNKKSWNCTGTFTNEFPGAC
VPPRRQTLCLGRTYLLHGGHEEHYKEHLLGASIYEAQLLKYKYKEKDENALCSIIQNSYG
DFADVIKGSDILKDYYGKKMEESLNKVNKDKKSNEESLKIFREKWWDENKENVWKVMSAV
LKNKETCKDYDKFQKTPQFLRWFKEWGDDFCEERKEKMYSFESFKVECKKKECDENTCQN
KCNEYKKWIDLKKSEYDKQVEKYTKDKNNNIYDNIDEVKNKEANVYLKEKSKECKDVNFD
DKIFNESPNEYEDMCKKCDEIKYLNEIKYPKTKHDIYDIDTFSNTIGSGTPISINANINE
QQNGKDTSKTGNTETQDSTVSPETESDAAINVEKLSGDENSSERREISDIKELSVTSNVN
EASDALTLETEDTGENTLANLRKEDKSLLSTKNQTDLDGRSKLEEQTAHEQSNGSDTGVN
VMTESNGSGITGRKKENEIDGGHNEVHSASNTQSSVSNTSDIRKEHSESSLNRTTHTQDI
KIGSSGNEQSDNQKNNSHSSDDSDSLTIKQDPSEDNTQNIYDLQDSHKDTFNTLVSSQSD
DEVNGIGGLDSSRDSESGRGDTISKTHDVRPMNIVREKHVNNHDFIRSGMTNNNVQNQYI
TPNGNNGIIRGQEESEGDEVNYEHNRARSNFSSENDHKKNIQEYNSRDTKRVREEIIKLS
KQNKCDNEYSMEYCTYSYERNSSPGPCSREERKKLCCQISDYCLKYFNFYSIEYYSCIKS
EINSPEYKCFKSEGPSNIPYFAAGGILVVIVLLLSSASRLGKSNEEYDIGEYNIEAAFEE
NNYLNKLSQIFNQEVQETNISDYSEYNYNEKNMY
Download sequence
Identical sequences A0A151L660
XP_012764396.2.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]