SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151LUR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151LUR6
Domain Number 1 Region: 493-809
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-48
Family Duffy binding domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 201-478
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-45
Family Duffy binding domain 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151LUR6
Sequence length 1427
Comment (tr|A0A151LUR6|A0A151LUR6_9APIC) Erythrocyte binding antigen-165 {ECO:0000313|EMBL:KYO02927.1} KW=Complete proteome OX=647221 OS=Plasmodium gaboni. GN=PGSY75_0424300 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFCISGFLFSCRTLCKLDNYLKNEYEKENSFNIINNKVEKEYDSGTNNNVNIDR
SSNGRLELLEVKEEALLNDKNIEEEEAENNINFEEKILYKNVYELNKENLEKEGLYKRNT
IKNIENDSLYKKGKLNFLYEYGMELLNINKVPMNKMTNSRGLGDSNMSFLDISNNNNKNK
NNNMNNLNSLSFVDMKSIHRCITKRKKGEKDWACNDKNTKEPNICVSDRRVQLCTGNLVD
LSINDATKEKFEEKLIIAAKREGTLLFEKFGKEYTAEFCLNLKWSYSDYGDIIKGTDMEG
VGRSIKVEFEIDRIFKSDQANSKENRKKWWDEISVKIWNAMIEEHKEKLPENIKECSKEK
PSDEPQINRWLMEWAYDTDYHKDKWYNKLDDPKSNCNSICPKERVCKSECTKYKTWVNKK
NSDFTILSAIYLKYNKTNLSYKTAFEYLQHKWYKYNELNFGSIFDQLNAKYYNKCVCQNS
MLGNNALFIKIENVCTNQEVKSIYGQLYCREKGNDKIWQCVNDNIKDFPDVCGPPRRQQL
CLGNLDKDEFKNVSDLRVFLNEIILGIKDEGKYLIEKYRKNMHENKYLNKMACKYLNYSF
DDYKNIILGKDMWRDTNSIKTENILKENFEAIKANIVRQYPSYADLSLDEFRKHWWDQNK
SQLWEAISCEFYNNNHTEVCLMEDDDDNQYLHWFREWKHDFCIEKTKRNNVIKEQCIDKV
IKTPEQMDNAHDVDAVCKKSCTDYDVWIINKLNEYKRQASKYKRDSSLYNDVIKNLKPWE
YLSMKCTECTCDLDTETFVYPYKGYENICKINGDPYDPKSIEGEEFNKPSLNVKSERSAP
SKDITEREAPGVDVLSIKETVHLEPFKPNAVDHISDPFIGRNSKEGGSSPRGANDILHTS
TEKHTYNDGVSASSSSLDSSSRSDVSSSDVEGFGVGQQEHGSDELLSSQTVTGGITESEG
TTLSQHENEPRQTHANLDGESVSMDSTKDTKHSSITSDVTHETNSLSVGENKDQETTLRE
GESVTTSPLEDETSTMNTHSDRTNIGQVSGVPVDSLSETQKEYRSGLETEQMKGEEVNAI
NPNNDMALKDDSVERREDENAHAKEHSGDSAPSKEHMNASQGTEHKLENSERPEKSKRAD
SRLESKSNKLSSTSHVNHNDSIERTSERSIDGSHNGYGHDRSDNPRHRMHINNRSRHGQL
ESDIVVRGDYINNNEEVKEDVESTLNDHRNNLNNMHNRTYNIEEYIYRDVNKVAHDIMKS
YKSNGCTNDLSSAYCSNLKKESLSNVCTNEDSRNLCCSISDYCMKFFNFNSSGYYSCMKK
EFANPEYKCFARKGFSNMYYFAGGGLFFIILFLLGTTSSIGKWSEENELNGTAFEEANFE
DAAFEVTTGQDSAFEEYGDNAYRIGLLMNQKIQSAKSSDYSEYHMDN
Download sequence
Identical sequences A0A151LUR6
XP_018643447.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]